Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  THE STRUCTURE OF A PREDICTED EPIMERASE PA4716 FROM PSEUDOMONAS AERUGINOSA
 
Authors :  M. E. Cuff, S. J. Ginell, F. J. Rotella, X. Xu, A. Savchenko, A. Edwards, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  13 Jul 04  (Deposition) - 14 Sep 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Sctructural Genomics, Mcsg, Pseudomonas Aeruginosa, Protein Structure Initiative, Structural Genomics, Psi, Midwest Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. E. Cuff, S. J. Ginell, F. J. Rotella, X. Xu, A. Savchenko, A. Edwards, A. Joachimiak
The Structure Of Hypothetical Protein Pa4716 From Pseudomonas Aeruginosa
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - GENE PRODUCT PA4716
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePA4716
    Organism ScientificPSEUDOMONAS AERUGINOSA
    Organism Taxid208964
    StrainPAO1

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 5)

Asymmetric/Biological Unit (1, 5)
No.NameCountTypeFull Name
1MSE5Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1U0K)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1U0K)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1U0K)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1U0K)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1U0K)

(-) Exons   (0, 0)

(no "Exon" information available for 1U0K)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:284
 aligned with Q9HV82_PSEAE | Q9HV82 from UniProtKB/TrEMBL  Length:284

    Alignment length:284
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280    
         Q9HV82_PSEAE     1 MSRRYWQLDVFAERPLTGNGLAVFDDASALDDAAMQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEMDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTSA 284
               SCOP domains -d1u0ka1 A:2-130 Hypothetical protein PA4716                                                                                      d1u0ka2 A:131-283 Hypothetical protein PA4716                                                                                                            - SCOP domains
               CATH domains -1u0kA01 A:2-118,A:270-284 Diaminopimelate Epimerase; Chain A, domain 1                                               1u0kA02 A:119-269 Diaminopimelate Epimerase; Chain A, domain 1                                                                                         1u0kA01         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee........eeeeee......hhhhhhhhhhhhh..eeeeeee.....eeeeeeee.........hhhhhhhhhhhhhhh....eeeeee....eeeeeeeee..eeeeeeeeee.ee....hhhhhhhhhhhh..hhhhh.....eeee....eeeee.hhhhhhh......hhhhhhhhh..eeeeee....eee............hhhhhhhhhhhhhhh........eeeeehhhhh..eeeeeee....eeeeeeeeeeeeeeee.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1u0k A   1 mSRRYWQLDVFAERPLTGNGLAVFDDASALDDAAmQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEmDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTSA 284
                            |       10        20        30    |   40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280    
                            |                                35-MSE                                                                              120-MSE                                                                                                                                                                
                            1-MSE                                                                                                                                                                                                                                                                                       

Chain B from PDB  Type:PROTEIN  Length:282
 aligned with Q9HV82_PSEAE | Q9HV82 from UniProtKB/TrEMBL  Length:284

    Alignment length:282
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281  
         Q9HV82_PSEAE     2 SRRYWQLDVFAERPLTGNGLAVFDDASALDDAAMQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEMDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTS 283
               SCOP domains d1u0kb1 B:2-130 Hypothetical protein PA4716                                                                                      d1u0kb2 B:131-283 Hypothetical protein PA4716                                                                                                             SCOP domains
               CATH domains 1u0kB01 B:2-118,B:270-283 Diaminopimelate Epimerase; Chain A, domain 1                                               1u0kB02 B:119-269 Diaminopimelate Epimerase; Chain A, domain 1                                                                                         1u0kB01        CATH domains
           Pfam domains (1) ------PhzC-PhzF-1u0kB01 B:8-278                                                                                                                                                                                                                                                      ----- Pfam domains (1)
           Pfam domains (2) ------PhzC-PhzF-1u0kB02 B:8-278                                                                                                                                                                                                                                                      ----- Pfam domains (2)
         Sec.struct. author ..eeeeeee........eeeeee......hhhhhhhhhhhhh..eeeeeee.....eeeeeeee........hhhhhhhhhhhhhhhh....eeeeeee..eeeeeeeee....eeeeeeeee.ee....hhhhhhhhhhhh..hhhhh.....eeee....eeeee.hhhhhh.......hhhhhhhhh..eeeeee....eee............hhhhhhhhhhhhhhh........eeeeehhhhh..eeeeeee....eeeeeeeeeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1u0k B   2 SRRYWQLDVFAERPLTGNGLAVFDDASALDDAAmQAWTRELRQFESIFLLPGDDPRAFRARIFTLEEELPFAGHPLLGAAALLHHLRGGDNEQHWTLHLASKSVALRSVRAGSGFYAEmDQGRAEFGATPDAGTCRWFAEAFSLSANDLSGHPPRVVSTGLPYLLLPVTAEALGRARQVNDLQEALDKLGAAFVYLLDVDGREGRTWDNLGLVEDVATGSAAGPVAAYLVEYGLAARGEPFVLHQGRFLERPSRLDVQVATDGSVRVGGHVQLLARAELLTS 283
                                    11        21        31   |    41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281  
                                                            35-MSE                                                                              120-MSE                                                                                                                                                               

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9HV82_PSEAE | Q9HV82)
molecular function
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
biological process
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1u0k)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1u0k)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1u0k
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9HV82_PSEAE | Q9HV82
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9HV82_PSEAE | Q9HV82
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1U0K)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1U0K)