Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE PUTATIVE MANNONATE DEHYDRATASE FROM ENTEROCOCCUS FAECALIS, NORTHEAST STRUCTURAL GENOMICS TARGET EFR41
 
Authors :  F. Forouhar, Y. Chen, R. Xiao, B. Cooper, R. Shastry, T. A. Acton, G. T. Mo J. F. Hunt, L. Tong, Northeast Structural Genomics Consortium (N
Date :  09 Jul 04  (Deposition) - 20 Jul 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.90
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Alpha-Beta Protein, Structural Genomics, Psi, Protein Structure Initiative, Northeast Structural Genomics Consortium, Nesg, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  F. Forouhar, Y. Chen, R. Xiao, B. Cooper, R. Shastry, T. A. Acton, G. T. Montelione, J. F. Hunt, L. Tong
Crystal Structure Of The Putative Mannonate Dehydratase Fro Enterococcus Faecalis, Northeast Structural Genomics Target Efr41
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - MANNONATE DEHYDRATASE
    Chains: A, B
    EC Number: 4.2.1.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: UXUA
    Organism Scientific: ENTEROCOCCUS FAECALIS
    Organism Taxid: 226185
    Strain: V583
    Synonym: D-MANNONATE HYDROLASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 20)

Asymmetric/Biological Unit (1, 20)
No.NameCountTypeFull Name
1MSE20Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 1TZ9)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TZ9)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Asp A:210 -Pro A:211
2Asp B:210 -Pro B:211

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TZ9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TZ9)

(-) Exons   (0, 0)

(no "Exon" information available for 1TZ9)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:344
 aligned with UXUA_ENTFA | Q82ZC9 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:353
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350   
           UXUA_ENTFA     1 MKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLALLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGISLVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENMQPEDMYQLIHSQSKGFRLPGWEEERLQQFQELKAMYAGVTEEDLVENLRYFLERVIPVCEEENIKMGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPANGITFCTGSLGADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDMAELMQALVDVGYEGVIRPDHGRAIWDEKAMPGYGLYDRAMGLTYIQGLYEATKAK 353
               SCOP domains d1tz9a_ A: Mannonate dehydratase UxuA                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains -1tz9A00 A:2-353 Divalent-metal-dependent TIM barrel enzymes                                                                                                                                                                                                                                                                                                      CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .ee............hhhhhh......eeee...........hhhhhhhhhhhhhhh..eeeee.....hhhhhhh..hhhhhhhhhhhhhhhhhhh...eeee...........eeeee.....eeeeeehhhhhh.hhhhhhhhh..---------.hhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh.eeee.................hhhhhhhhhhhh....ee..ee.hhhhhh...hhhhhhhhhhhhh..eee..eee....eeee...hhhhh..hhhhhhhhhhhhh...eeee................hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tz9 A   1 mKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLALLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGISLVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENmQPEDmYQLIHS---------WEEERLQQFQELKAmYAGVTEEDLVENLRYFLERVIPVCEEENIKmGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPANGITFCTGSLGADPTNDLPTmIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDmAELmQALVDVGYEGVIRPDHGRAIWDEKAmPGYGLYDRAmGLTYIQGLYEATKAK 353
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140  |     |-       160       170  |    180       190       200   |   210       220       230       240       250       260       270       280       290       300 |     310       320       330       340       350   
                            |                                                                                                                                      138-MSE|   149       159           173-MSE                        204-MSE                                                 260-MSE                               298-MSE                       328-MSE   338-MSE           
                            1-MSE                                                                                                                                       143-MSE                                                                                                                                                        302-MSE                                               


Chain B from PDB  Type:PROTEIN  Length:344
 aligned with UXUA_ENTFA | Q82ZC9 from UniProtKB/Swiss-Prot  Length:357

    Alignment length:353
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350   
           UXUA_ENTFA     1 MKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLALLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGISLVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENMQPEDMYQLIHSQSKGFRLPGWEEERLQQFQELKAMYAGVTEEDLVENLRYFLERVIPVCEEENIKMGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPANGITFCTGSLGADPTNDLPTMIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDMAELMQALVDVGYEGVIRPDHGRAIWDEKAMPGYGLYDRAMGLTYIQGLYEATKAK 353
               SCOP domains d1tz9b_ B: Mannonate dehydratase UxuA                                                                                                                                                                                                                                                                                                                             SCOP domains
               CATH domains -1tz9B00 B:2-353 Divalent-metal-dependent TIM barrel enzymes                                                                                                                                                                                                                                                                                                      CATH domains
           Pfam domains (1) UxuA-1tz9B01 B:1-352                                                                                                                                                                                                                                                                                                                                            - Pfam domains (1)
           Pfam domains (2) UxuA-1tz9B02 B:1-352                                                                                                                                                                                                                                                                                                                                            - Pfam domains (2)
         Sec.struct. author .ee............hhhhhh......eeee...........hhhhhhhhhhhhhhh..eeeee.....hhhhhhh..hhhhhhhhhhhhhhhhhhh...eeee...........eeeee.....eeeeehhhhhhh.hhhhhhhhh..---------....hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh.eeee.................hhhhhhhhhhhh....eeeeeehhhhhh....hhhhhhhhh...eeeee...ee......eee..........hhhhhhhhhhhh....ee..................hhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tz9 B   1 mKWGFRWYGAAGDAIPLKHIRQIPGITGVVGTLLNKLPGDVWTVAEIQALKQSVEQEGLALLGIESVAIHDAIKAGTDQRDHYIDNYRQTLRNLGKCGISLVCYSFKPIFGWAKTDLAYENEDGSLSLLFDQAVVENmQPEDmYQLIHS---------WEEERLQQFQELKAmYAGVTEEDLVENLRYFLERVIPVCEEENIKmGIHPDDPPWEIFGLPRITKNLADLKRILSLVDSPANGITFCTGSLGADPTNDLPTmIREIGHRINFVHFRNVKYLGEHRFEETAHPSVAGSLDmAELmQALVDVGYEGVIRPDHGRAIWDEKAmPGYGLYDRAmGLTYIQGLYEATKAK 353
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130       140  |     |-       160       170  |    180       190       200   |   210       220       230       240       250       260       270       280       290       300 |     310       320       330       340       350   
                            1-MSE                                                                                                                                  138-MSE|   149       159           173-MSE                        204-MSE                                                 260-MSE                               298-MSE                       328-MSE   338-MSE           
                                                                                                                                                                        143-MSE                                                                                                                                                        302-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: TIM_barrel (694)

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (UXUA_ENTFA | Q82ZC9)
molecular function
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0008927    mannonate dehydratase activity    Catalysis of the reaction: D-mannonate = 2-dehydro-3-deoxy-D-gluconate + H(2)O.
biological process
    GO:0006064    glucuronate catabolic process    The chemical reactions and pathways resulting in the breakdown of glucuronate, any salt or ester of glucuronic acid.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 1tz9)
 
  Cis Peptide Bonds
    Asp A:210 - Pro A:211   [ RasMol ]  
    Asp B:210 - Pro B:211   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tz9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UXUA_ENTFA | Q82ZC9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  UXUA_ENTFA | Q82ZC9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1TZ9)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TZ9)