1TXH - JenaLib

Theoretical Model (83, 498)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_002018	I	20	S	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	I	20	S
02	UniProt	VAR_002019	G	21	D	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	G	21	D
03	UniProt	VAR_002020	R	22	G	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	R	22	G
04	UniProt	VAR_002021	R	22	P	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	R	22	P
05	UniProt	VAR_002022	R	22	Q	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	R	22	Q
06	UniProt	VAR_002023	V	23	A	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	V	23	A
07	UniProt	VAR_029898	W	24	C	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	W	24	C
08	UniProt	VAR_002024	L	25	F	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	25	F
09	UniProt	VAR_029899	L	25	P	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	25	P
10	UniProt	VAR_002025	S	26	L	CXB1_HUMAN	Disease (CMTX1)	587777876	A/B/C/D/E/F	S	26	L
11	UniProt	VAR_029900	S	26	W	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	S	26	W
12	UniProt	VAR_029901	I	28	N	CXB1_HUMAN	Disease (CMTX1)	768834663	A/B/C/D/E/F	I	28	N
13	UniProt	VAR_002026	I	28	T	CXB1_HUMAN	Disease (CMTX1)	768834663	A/B/C/D/E/F	I	28	T
14	UniProt	VAR_002028	F	29	L	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	F	29	L
15	UniProt	VAR_002029	I	30	N	CXB1_HUMAN	Disease (CMTX1)	104894817	A/B/C/D/E/F	I	30	N
16	UniProt	VAR_029902	I	30	T	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	I	30	T
17	UniProt	VAR_029903	M	34	I	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	M	34	I
18	UniProt	VAR_029904	M	34	K	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	M	34	K
19	UniProt	VAR_002030	M	34	T	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	M	34	T
20	UniProt	VAR_002031	M	34	V	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	M	34	V
21	UniProt	VAR_002032	V	35	M	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	V	35	M
22	UniProt	VAR_029905	V	37	M	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	V	37	M
23	UniProt	VAR_002033	V	38	M	CXB1_HUMAN	Disease (CMTX1)	879254012	A/B/C/D/E/F	V	38	M
24	UniProt	VAR_002034	A	39	P	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	A	39	P
25	UniProt	VAR_002035	A	39	V	CXB1_HUMAN	Disease (CMTX1)	786204095	A/B/C/D/E/F	A	39	V
26	UniProt	VAR_029906	A	40	T	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	A	40	T
27	UniProt	VAR_002036	A	40	V	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	A	40	V
28	UniProt	VAR_002054	W	77	S	CXB1_HUMAN	Disease (CMTX1)	199570177	A/B/C/D/E/F	W	77	S
29	UniProt	VAR_002055	Q	80	R	CXB1_HUMAN	Disease (CMTX1)	879254097	A/B/C/D/E/F	Q	80	R
30	UniProt	VAR_002056	L	81	F	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	81	F
31	UniProt	VAR_002057	L	83	P	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	83	P
32	UniProt	VAR_002058	V	84	I	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	V	84	I
33	UniProt	VAR_002059	S	85	C	CXB1_HUMAN	Disease (CMTX1)	104894823	A/B/C/D/E/F	S	85	C
34	UniProt	VAR_002060	S	85	F	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	S	85	F
35	UniProt	VAR_002061	T	86	A	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	T	86	A
36	UniProt	VAR_002062	T	86	N	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	T	86	N
37	UniProt	VAR_002063	T	86	S	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	T	86	S
38	UniProt	VAR_002064	P	87	A	CXB1_HUMAN	Disease (CMTX1)	587777877	A/B/C/D/E/F	P	87	A
39	UniProt	VAR_002065	P	87	L	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	P	87	L
40	UniProt	VAR_002066	P	87	S	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	P	87	S
41	UniProt	VAR_002067	L	89	P	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	89	P
42	UniProt	VAR_002068	L	90	H	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	90	H
43	UniProt	VAR_029915	L	90	V	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	90	V
44	UniProt	VAR_029916	V	91	M	CXB1_HUMAN	Disease (CMTX1)	756928158	A/B/C/D/E/F	V	91	M
45	UniProt	VAR_002069	M	93	V	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	M	93	V
46	UniProt	VAR_029917	H	94	D	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	H	94	D
47	UniProt	VAR_002070	H	94	Q	CXB1_HUMAN	Disease (CMTX1)	756000896	A/B/C/D/E/F	H	94	Q
48	UniProt	VAR_002071	H	94	Y	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	H	94	Y
49	UniProt	VAR_002072	V	95	M	CXB1_HUMAN	Disease (CMTX1)	104894821	A/B/C/D/E/F	V	95	M
50	UniProt	VAR_029927	L	131	P	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	131	P
51	UniProt	VAR_002080	W	133	C	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	W	133	C
52	UniProt	VAR_002081	W	133	R	CXB1_HUMAN	Disease (CMTX1)	104894813	A/B/C/D/E/F	W	133	R
53	UniProt	VAR_002082	Y	135	C	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	Y	135	C
54	UniProt	VAR_021611	V	136	A	CXB1_HUMAN	Disease (DSS)	104894826	A/B/C/D/E/F	V	136	A
55	UniProt	VAR_029928	S	138	N	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	S	138	N
56	UniProt	VAR_002083	V	139	M	CXB1_HUMAN	Disease (CMTX1)	104894812	A/B/C/D/E/F	V	139	M
57	UniProt	VAR_002084	F	141	L	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	F	141	L
58	UniProt	VAR_002085	R	142	E	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	R	142	E
59	UniProt	VAR_029929	R	142	Q	CXB1_HUMAN	Disease (CMTX1)	786204123	A/B/C/D/E/F	R	142	Q
60	UniProt	VAR_002086	R	142	W	CXB1_HUMAN	Disease (CMTX1)	104894810	A/B/C/D/E/F	R	142	W
61	UniProt	VAR_029930	E	146	K	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	E	146	K
62	UniProt	VAR_029931	A	147	D	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	A	147	D
63	UniProt	VAR_002088	F	149	I	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	F	149	I
64	UniProt	VAR_029932	F	149	V	CXB1_HUMAN	Unclassified (CMTX1)	---	A/B/C/D/E/F	F	149	V
65	UniProt	VAR_029933	Y	151	S	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	Y	151	S
66	UniProt	VAR_002116	V	189	G	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	V	189	G
67	UniProt	VAR_002117	V	189	I	CXB1_HUMAN	Disease (CMTX1)	770116247	A/B/C/D/E/F	V	189	I
68	UniProt	VAR_029944	T	191	A	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	T	191	A
69	UniProt	VAR_029945	V	192	F	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	V	192	F
70	UniProt	VAR_002119	F	193	C	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	F	193	C
71	UniProt	VAR_029946	F	193	L	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	F	193	L
72	UniProt	VAR_002120	M	194	V	CXB1_HUMAN	Disease (CMTX1)	587777878	A/B/C/D/E/F	M	194	V
73	UniProt	VAR_002121	S	198	F	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	S	198	F
74	UniProt	VAR_002122	G	199	R	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	G	199	R
75	UniProt	VAR_002123	C	201	R	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	C	201	R
76	UniProt	VAR_029947	C	201	Y	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	C	201	Y
77	UniProt	VAR_002124	I	203	N	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	I	203	N
78	UniProt	VAR_002125	L	204	F	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	204	F
79	UniProt	VAR_029948	L	204	V	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	L	204	V
80	UniProt	VAR_029949	N	205	I	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	N	205	I
81	UniProt	VAR_002126	N	205	S	CXB1_HUMAN	Disease (CMTX1)	104894822	A/B/C/D/E/F	N	205	S
82	UniProt	VAR_029950	E	208	G	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	E	208	G
83	UniProt	VAR_002127	E	208	K	CXB1_HUMAN	Disease (CMTX1)	---	A/B/C/D/E/F	E	208	K

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (1, 6)

Sequences/Alignments

Theoretical Model

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:86
 aligned with CXB1_HUMAN | P08034 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:191
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208 
           CXB1_HUMAN    19 AIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEV 209
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................-----------------------------------.....................----------------------------------......................------------------------------------..................... Sec.struct. author
             SAPs(SNPs) (1) -SDGACFL-NLN---IM-MMPT------------------------------------S--RF-PICAA-PHM-VDM-----------------------------------P-C-CA-NM-LE---KD-I-S-------------------------------------G-AFCV---FR-R-NFI--G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---P--PW-T-T---K----VV--------------------------------------------FNL--V---Q--------------------------------------R--------Q------V---------------------------------------I---L-------Y--VS--K- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---Q-----------T---------------------------------------------------SS------Y-----------------------------------------------W------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4c  PDB: A:19-209 (gaps) UniProt: 1-289 [INCOMPLETE]                                                                                                                                     Transcript 1
                 1txh A  19 AIGRVWLSVIFIFRIMVLVVAA-----------------------------------LWSLQLILVSTPALLVAMHVA----------------------------------LWWTYVISVVFRLLFEAVFMYV------------------------------------VFTVFMLAASGICIILNVAEV 209
                                    28        38 |       -         -         -       |78        88       | -         -         -         -  |    138       148   |     -         -         -         -|      198       208 
                                                40                                  76                  96                                131                  152                                  189

Chain B from PDB  Type:PROTEIN  Length:86
 aligned with CXB1_HUMAN | P08034 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:191
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208 
           CXB1_HUMAN    19 AIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEV 209
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................-----------------------------------.....................----------------------------------......................------------------------------------..................... Sec.struct. author
             SAPs(SNPs) (1) -SDGACFL-NLN---IM-MMPT------------------------------------S--RF-PICAA-PHM-VDM-----------------------------------P-C-CA-NM-LE---KD-I-S-------------------------------------G-AFCV---FR-R-NFI--G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---P--PW-T-T---K----VV--------------------------------------------FNL--V---Q--------------------------------------R--------Q------V---------------------------------------I---L-------Y--VS--K- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---Q-----------T---------------------------------------------------SS------Y-----------------------------------------------W------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4c  PDB: B:19-209 (gaps) UniProt: 1-289 [INCOMPLETE]                                                                                                                                     Transcript 1
                 1txh B  19 AIGRVWLSVIFIFRIMVLVVAA-----------------------------------LWSLQLILVSTPALLVAMHVA----------------------------------LWWTYVISVVFRLLFEAVFMYV------------------------------------VFTVFMLAASGICIILNVAEV 209
                                    28        38 |       -         -         -       |78        88       | -         -         -         -  |    138       148   |     -         -         -         -|      198       208 
                                                40                                  76                  96                                131                  152                                  189

Chain C from PDB  Type:PROTEIN  Length:86
 aligned with CXB1_HUMAN | P08034 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:191
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208 
           CXB1_HUMAN    19 AIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEV 209
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................-----------------------------------.....................----------------------------------......................------------------------------------..................... Sec.struct. author
             SAPs(SNPs) (1) -SDGACFL-NLN---IM-MMPT------------------------------------S--RF-PICAA-PHM-VDM-----------------------------------P-C-CA-NM-LE---KD-I-S-------------------------------------G-AFCV---FR-R-NFI--G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---P--PW-T-T---K----VV--------------------------------------------FNL--V---Q--------------------------------------R--------Q------V---------------------------------------I---L-------Y--VS--K- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---Q-----------T---------------------------------------------------SS------Y-----------------------------------------------W------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4c  PDB: C:19-209 (gaps) UniProt: 1-289 [INCOMPLETE]                                                                                                                                     Transcript 1
                 1txh C  19 AIGRVWLSVIFIFRIMVLVVAA-----------------------------------LWSLQLILVSTPALLVAMHVA----------------------------------LWWTYVISVVFRLLFEAVFMYV------------------------------------VFTVFMLAASGICIILNVAEV 209
                                    28        38 |       -         -         -       |78        88       | -         -         -         -  |    138       148   |     -         -         -         -|      198       208 
                                                40                                  76                  96                                131                  152                                  189

Chain D from PDB  Type:PROTEIN  Length:86
 aligned with CXB1_HUMAN | P08034 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:191
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208 
           CXB1_HUMAN    19 AIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEV 209
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................-----------------------------------.....................----------------------------------......................------------------------------------..................... Sec.struct. author
             SAPs(SNPs) (1) -SDGACFL-NLN---IM-MMPT------------------------------------S--RF-PICAA-PHM-VDM-----------------------------------P-C-CA-NM-LE---KD-I-S-------------------------------------G-AFCV---FR-R-NFI--G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---P--PW-T-T---K----VV--------------------------------------------FNL--V---Q--------------------------------------R--------Q------V---------------------------------------I---L-------Y--VS--K- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---Q-----------T---------------------------------------------------SS------Y-----------------------------------------------W------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4c  PDB: D:19-209 (gaps) UniProt: 1-289 [INCOMPLETE]                                                                                                                                     Transcript 1
                 1txh D  19 AIGRVWLSVIFIFRIMVLVVAA-----------------------------------LWSLQLILVSTPALLVAMHVA----------------------------------LWWTYVISVVFRLLFEAVFMYV------------------------------------VFTVFMLAASGICIILNVAEV 209
                                    28        38 |       -         -         -       |78        88       | -         -         -         -  |    138       148   |     -         -         -         -|      198       208 
                                                40                                  76                  96                                131                  152                                  189

Chain E from PDB  Type:PROTEIN  Length:86
 aligned with CXB1_HUMAN | P08034 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:191
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208 
           CXB1_HUMAN    19 AIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEV 209
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................-----------------------------------.....................----------------------------------......................------------------------------------..................... Sec.struct. author
             SAPs(SNPs) (1) -SDGACFL-NLN---IM-MMPT------------------------------------S--RF-PICAA-PHM-VDM-----------------------------------P-C-CA-NM-LE---KD-I-S-------------------------------------G-AFCV---FR-R-NFI--G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---P--PW-T-T---K----VV--------------------------------------------FNL--V---Q--------------------------------------R--------Q------V---------------------------------------I---L-------Y--VS--K- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---Q-----------T---------------------------------------------------SS------Y-----------------------------------------------W------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4c  PDB: E:19-209 (gaps) UniProt: 1-289 [INCOMPLETE]                                                                                                                                     Transcript 1
                 1txh E  19 AIGRVWLSVIFIFRIMVLVVAA-----------------------------------LWSLQLILVSTPALLVAMHVA----------------------------------LWWTYVISVVFRLLFEAVFMYV------------------------------------VFTVFMLAASGICIILNVAEV 209
                                    28        38 |       -         -         -       |78        88       | -         -         -         -  |    138       148   |     -         -         -         -|      198       208 
                                                40                                  76                  96                                131                  152                                  189

Chain F from PDB  Type:PROTEIN  Length:86
 aligned with CXB1_HUMAN | P08034 from UniProtKB/Swiss-Prot  Length:283

    Alignment length:191
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208 
           CXB1_HUMAN    19 AIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGCNSVCYDQFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVHISGTLWWTYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEV 209
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......................-----------------------------------.....................----------------------------------......................------------------------------------..................... Sec.struct. author
             SAPs(SNPs) (1) -SDGACFL-NLN---IM-MMPT------------------------------------S--RF-PICAA-PHM-VDM-----------------------------------P-C-CA-NM-LE---KD-I-S-------------------------------------G-AFCV---FR-R-NFI--G- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---P--PW-T-T---K----VV--------------------------------------------FNL--V---Q--------------------------------------R--------Q------V---------------------------------------I---L-------Y--VS--K- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ---Q-----------T---------------------------------------------------SS------Y-----------------------------------------------W------------------------------------------------------------------- SAPs(SNPs) (3)
             SAPs(SNPs) (4) ---------------V------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (4)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.4c  PDB: F:19-209 (gaps) UniProt: 1-289 [INCOMPLETE]                                                                                                                                     Transcript 1
                 1txh F  19 AIGRVWLSVIFIFRIMVLVVAA-----------------------------------LWSLQLILVSTPALLVAMHVA----------------------------------LWWTYVISVVFRLLFEAVFMYV------------------------------------VFTVFMLAASGICIILNVAEV 209
                                    28        38 |       -         -         -       |78        88       | -         -         -         -  |    138       148   |     -         -         -         -|      198       208 
                                                40                                  76                  96                                131                  152                                  189

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (19, 19)

Theoretical Model(hide GO term definitions)

Chain A,B,C,D,E,F (CXB1_HUMAN | P08034)

molecular function
	GO:0005243	gap junction channel activity	A wide pore channel activity that enables a direct cytoplasmic connection from one cell to an adjacent cell. The gap junction can pass large solutes as well as electrical signals between cells. Gap junctions consist of two gap junction hemi-channels, or connexons, one contributed by each membrane through which the gap junction passes.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0007154	cell communication	Any process that mediates interactions between a cell and its surroundings. Encompasses interactions such as signaling or attachment between one cell and another cell, between a cell and an extracellular matrix, or between a cell and any other aspect of its environment.
	GO:0007267	cell-cell signaling	Any process that mediates the transfer of information from one cell to another. This process includes signal transduction in the receiving cell and, where applicable, release of a ligand and any processes that actively facilitate its transport and presentation to the receiving cell. Examples include signaling via soluble ligands, via cell adhesion molecules and via gap junctions.
	GO:0016264	gap junction assembly	Assembly of gap junctions, which are found in most animal tissues, and serve as direct connections between the cytoplasms of adjacent cells. They provide open channels through the plasma membrane, allowing ions and small molecules (less than approximately a thousand daltons) to diffuse freely between neighboring cells, but preventing the passage of proteins and nucleic acids.
	GO:0007399	nervous system development	The process whose specific outcome is the progression of nervous tissue over time, from its formation to its mature state.
	GO:0051259	protein oligomerization	The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
	GO:0015868	purine ribonucleotide transport	The directed movement of a purine ribonucleotide, any compound consisting of a purine ribonucleoside (a purine organic base attached to a ribose sugar) esterified with (ortho)phosphate, into, out of or within a cell.
	GO:0055085	transmembrane transport	The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0030054	cell junction	A cellular component that forms a specialized region of connection between two or more cells or between a cell and the extracellular matrix. At a cell junction, anchoring proteins extend through the plasma membrane to link cytoskeletal proteins in one cell to cytoskeletal proteins in neighboring cells or to proteins in the extracellular matrix.
	GO:0005922	connexin complex	An assembly of six molecules of connexin, made in the Golgi apparatus and subsequently transported to the plasma membrane, where docking of two connexons on apposed plasma membranes across the extracellular space forms a gap junction.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005921	gap junction	A cell-cell junction composed of pannexins or innexins and connexins, two different families of channel-forming proteins.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (83, 498)

PROSITE Motifs (0, 0)

Exons (1, 6)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (19, 19)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File