|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 2)
|
Asymmetric Unit (2, 2)
|
(no "SS Bond" information available for 1TW7) |
(no "Cis Peptide Bond" information available for 1TW7) |
(no "SAP(SNP)/Variant" information available for 1TW7) |
(no "PROSITE Motif" information available for 1TW7) |
(no "Exon" information available for 1TW7) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:99 aligned with Q5RTL1_9HIV1 | Q5RTL1 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 Q5RTL1_9HIV1 1 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF 99 SCOP domains d1tw7a_ A: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 1tw7A00 A:1-99 Acid Proteases CATH domains Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 1tw7 A 1 PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF 99 10 20 30 40 50 60 70 80 90 Chain B from PDB Type:PROTEIN Length:99 aligned with Q5RTL1_9HIV1 | Q5RTL1 from UniProtKB/TrEMBL Length:99 Alignment length:99 10 20 30 40 50 60 70 80 90 Q5RTL1_9HIV1 1 PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF 99 SCOP domains d1tw7b_ B: Human immunodeficiency virus type 1 protease SCOP domains CATH domains 1tw7B00 B:1-99 Acid Proteases CATH domains Pfam domains (1) ---RVP-1tw7B01 B:4-98 - Pfam domains (1) Pfam domains (2) ---RVP-1tw7B02 B:4-98 - Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------- Transcript 1tw7 B 1 PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPTPANVIGRNLMTQIGCTLNF 99 10 20 30 40 50 60 70 80 90
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q5RTL1_9HIV1 | Q5RTL1)
|
|
|
|
|
|
|