1TVM - JenaLib

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with PTKB_ECO57 | P0A436 from UniProtKB/Swiss-Prot  Length:94

    Alignment length:113
                                               1                                                                                             
                                     -         1        11        21        31        41        51        61        71        81        91   
           PTKB_ECO57     - -------------------MKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG  94
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------PTS_IIB-1tvmA01 A:23-108                                                              ----- Pfam domains
         Sec.struct. author .....................eeeeee.....hhhhhhhhhhhhhhhhh...eeeeee.............eeee............ee.hhhhhhh.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ---------------------PTS_EIIB_TYPE_2  PDB: A:22-113 UniProt: 3-94                                                 PROSITE (2)
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 1tvm A   1 MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG 113
                                    10        20        30        40        50        60        70        80        90       100       110

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with PTKB_ECOL6 | P0A435 from UniProtKB/Swiss-Prot  Length:94

    Alignment length:113
                                               1                                                                                             
                                     -         1        11        21        31        41        51        61        71        81        91   
           PTKB_ECOL6     - -------------------MKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG  94
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------PTS_IIB-1tvmA01 A:23-108                                                              ----- Pfam domains
         Sec.struct. author .....................eeeeee.....hhhhhhhhhhhhhhhhh...eeeeee.............eeee............ee.hhhhhhh.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------PTS_EIIB_TYPE_2  PDB: A:22-113 UniProt: 3-94                                                 PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 1tvm A   1 MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG 113
                                    10        20        30        40        50        60        70        80        90       100       110

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with PTKB_SHIFL | P0A437 from UniProtKB/Swiss-Prot  Length:94

    Alignment length:113
                                               1                                                                                             
                                     -         1        11        21        31        41        51        61        71        81        91   
           PTKB_SHIFL     - -------------------MKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG  94
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------PTS_IIB-1tvmA01 A:23-108                                                              ----- Pfam domains
         Sec.struct. author .....................eeeeee.....hhhhhhhhhhhhhhhhh...eeeeee.............eeee............ee.hhhhhhh.hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) ----------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) ---------------------PTS_EIIB_TYPE_2  PDB: A:22-113 UniProt: 3-94                                                 PROSITE (3)
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 1tvm A   1 MGSSHHHHHHHHENLYFQGSKRKIIVACGGAVATSTMAAEEIKELCQSHNIPVELIQCRVNEIETYMDGVHLICTTARVDRSFGDIPLVHGMPFVSGVGIEALQNKILTILQG 113
                                    10        20        30        40        50        60        70        80        90       100       110

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (1, 1)

Gene Ontology (8, 24)

NMR Structure(hide GO term definitions)

Chain A (PTKB_ECO57 | P0A436)

molecular function
	GO:0008982	protein-N(PI)-phosphohistidine-sugar phosphotransferase activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034219	carbohydrate transmembrane transport	The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0019402	galactitol metabolic process	The chemical reactions and pathways involving galactitol, the hexitol derived by the reduction of the aldehyde group of either D- or L-galactose.
	GO:0009401	phosphoenolpyruvate-dependent sugar phosphotransferase system	The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A (PTKB_SHIFL | P0A437)

molecular function
	GO:0008982	protein-N(PI)-phosphohistidine-sugar phosphotransferase activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034219	carbohydrate transmembrane transport	The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0019402	galactitol metabolic process	The chemical reactions and pathways involving galactitol, the hexitol derived by the reduction of the aldehyde group of either D- or L-galactose.
	GO:0009401	phosphoenolpyruvate-dependent sugar phosphotransferase system	The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Chain A (PTKB_ECOL6 | P0A435)

molecular function
	GO:0008982	protein-N(PI)-phosphohistidine-sugar phosphotransferase activity	Catalysis of the PEP-dependent, phosphoryl transfer-driven transport of substances across a membrane. The transport happens by catalysis of the reaction: protein N-phosphohistidine + sugar(out) = protein histidine + sugar phosphate(in). This differs from primary and secondary active transport in that the solute is modified during transport.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0034219	carbohydrate transmembrane transport	The process in which a carbohydrate is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
	GO:0008643	carbohydrate transport	The directed movement of carbohydrate into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Carbohydrates are any of a group of organic compounds based of the general formula Cx(H2O)y.
	GO:0019402	galactitol metabolic process	The chemical reactions and pathways involving galactitol, the hexitol derived by the reduction of the aldehyde group of either D- or L-galactose.
	GO:0009401	phosphoenolpyruvate-dependent sugar phosphotransferase system	The uptake and phosphorylation of specific carbohydrates from the extracellular environment; uptake and phosphorylation are coupled, making the PTS a link between the uptake and metabolism of sugars; phosphoenolpyruvate is the original phosphate donor; phosphoenolpyruvate passes the phosphate via a signal transduction pathway, to enzyme 1 (E1), which in turn passes it on to the histidine protein, HPr; the next step in the system involves sugar-specific membrane-bound complex, enzyme 2 (EII), which transports the sugar into the cell; it includes the sugar permease, which catalyzes the transport reactions; EII is usually divided into three different domains, EIIA, EIIB, and EIIC.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1tvm
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PTKB_ECO57 \| P0A436
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PTKB_ECOL6 \| P0A435
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PTKB_SHIFL \| P0A437
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.1.69
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments