|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1TTW) |
Sites (0, 0)| (no "Site" information available for 1TTW) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1TTW) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1TTW) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1TTW) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1TTW) |
Exons (0, 0)| (no "Exon" information available for 1TTW) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:118 aligned with Q7BTX0_YERPE | Q7BTX0 from UniProtKB/TrEMBL Length:141 Alignment length:118 12 22 32 42 52 62 72 82 92 102 112 Q7BTX0_YERPE 3 TYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLS 120 SCOP domains d1ttwa_ A: Putative YopH chaperone SycH SCOP domains CATH domains 1ttwA00 A:3-120 [code=3.30.1460.10, no name defined] CATH domains Pfam domains ---------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------------------------------------- Transcript 1ttw A 3 TYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPINEKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSGTQLASVLTSLVDKAVTLS 120 12 22 32 42 52 62 72 82 92 102 112 Chain B from PDB Type:PROTEIN Length:20 aligned with Q93KQ4_YEREN | Q93KQ4 from UniProtKB/TrEMBL Length:116 Alignment length:20 46 56 Q93KQ4_YEREN 37 VSTQAITSDERRFAYAVLEH 56 SCOP domains -------------------- SCOP domains CATH domains -------------------- CATH domains Pfam domains YopH_N-1ttwB01 Pfam domains SAPs(SNPs) -------------------- SAPs(SNPs) PROSITE -------------------- PROSITE Transcript -------------------- Transcript 1ttw B 33 VSTQAITSDERRFAYAVLEH 52 42 52
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (6, 6)|
Asymmetric Unit(hide GO term definitions) Chain A (Q7BTX0_YERPE | Q7BTX0)
Chain B (Q93KQ4_YEREN | Q93KQ4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|