Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE TR1C FRAGMENT OF SKELETAL MUSCLE TROPONIN-C
 
Authors :  W. A. Findlay, F. D. Soennichsen, B. D. Sykes
Date :  29 Dec 93  (Deposition) - 15 Oct 94  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Muscle Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. A. Findlay, F. D. Sonnichsen, B. D. Sykes
Solution Structure Of The Tr1C Fragment Of Skeletal Muscle Troponin-C.
J. Biol. Chem. V. 269 6773 1994
PubMed-ID: 8120037
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TROPONIN C
    Chains: A
    Engineered: YES
    Organism Common: TURKEY
    Organism Scientific: MELEAGRIS GALLOPAVO
    Organism Taxid: 9103

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TRF)

(-) Sites  (0, 0)

(no "Site" information available for 1TRF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TRF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TRF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TRF)

(-) PROSITE Motifs  (2, 4)

NMR Structure (2, 4)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_HAND_2PS50222 EF-hand calcium-binding domain profile.TNNC2_MELGA17-52
53-88
93-128
129-162		  2A:17-52
A:53-87
-
-
2EF_HAND_1PS00018 EF-hand calcium-binding domain.TNNC2_MELGA30-42
66-78
106-118
142-154		  2A:30-42
A:66-78
-
-

(-) Exons   (0, 0)

(no "Exon" information available for 1TRF)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:76
 aligned with TNNC2_MELGA | P10246 from UniProtKB/Swiss-Prot  Length:162

    Alignment length:76
                                    21        31        41        51        61        71        81      
           TNNC2_MELGA   12 AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK 87
               SCOP domains d1trfa_ A: Troponin C                                                        SCOP domains
               CATH domains 1trfA00 A:12-87 EF-hand                                                      CATH domains
           Pfam domains (1) --EF_hand_5-1trfA01 A:14-82                                            ----- Pfam domains (1)
           Pfam domains (2) ---------------------EF_hand_6-1trfA02 A:33-85                            -- Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhhhhhh......eeehhhhhhhhhhhh...hhhhhhhhhhhh......eeehhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) -----EF_HAND_2  PDB: A:17-52             EF_HAND_2  PDB: A:53-87             PROSITE (1)
                PROSITE (2) ------------------EF_HAND_1    -----------------------EF_HAND_1    --------- PROSITE (2)
                 Transcript ---------------------------------------------------------------------------- Transcript
                  1trf A 12 AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK 87
                                    21        31        41        51        61        71        81
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (2, 2)

NMR Structure
(-)
Clan: EF_hand (270)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (TNNC2_MELGA | P10246)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1trf)
 
  Sites
(no "Sites" information available for 1trf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1trf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1trf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TNNC2_MELGA | P10246
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  TNNC2_MELGA | P10246
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        TNNC2_MELGA | P10246: 5tnc

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TRF)