Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THREE-DIMENSIONAL STRUCTURE OF THEILER VIRUS
 
Authors :  R. A. Grant, D. J. Filman, J. M. Hogle
Date :  30 Jan 92  (Deposition) - 31 Jan 94  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.80
Chains :  Asym. Unit :  1,2,3,4
Biol. Unit 1:  1,2,3,4  (60x)
Keywords :  Virus, Icosahedral Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. A. Grant, D. J. Filman, R. S. Fujinami, J. P. Icenogle, J. M. Hogle
Three-Dimensional Structure Of Theiler Virus.
Proc. Natl. Acad. Sci. Usa V. 89 2061 1992
PubMed-ID: 1549565  |  Reference-DOI: 10.1073/PNAS.89.6.2061
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP1)
    Chains1
    EngineeredYES
    OrganBEAN
    Organism ScientificTHEILER'S ENCEPHALOMYELITIS VIRUS (STRAIN DA)
    Organism Taxid12126
    StrainDA
 
Molecule 2 - THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP2)
    Chains2
    EngineeredYES
    OrganBEAN
    Organism ScientificTHEILER'S ENCEPHALOMYELITIS VIRUS (STRAIN DA)
    Organism Taxid12126
    StrainDA
 
Molecule 3 - THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP3)
    Chains3
    EngineeredYES
    OrganBEAN
    Organism ScientificTHEILER'S ENCEPHALOMYELITIS VIRUS (STRAIN DA)
    Organism Taxid12126
    StrainDA
 
Molecule 4 - THEILER'S MURINE ENCEPHALOMYELITIS VIRUS (SUBUNIT VP4)
    Chains4
    EngineeredYES
    OrganBEAN
    Organism ScientificTHEILER'S ENCEPHALOMYELITIS VIRUS (STRAIN DA)
    Organism Taxid12126
    StrainDA

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit 1234
Biological Unit 1 (60x)1234

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TME)

(-) Sites  (0, 0)

(no "Site" information available for 1TME)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TME)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Phe 1:104 -Pro 1:105
2Leu 2:84 -Pro 2:85

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TME)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TME)

(-) Exons   (0, 0)

(no "Exon" information available for 1TME)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain 1 from PDB  Type:PROTEIN  Length:256
 aligned with POLG_TMEVD | P13899 from UniProtKB/Swiss-Prot  Length:2301

    Alignment length:256
                                   656       666       676       686       696       706       716       726       736       746       756       766       776       786       796       806       816       826       836       846       856       866       876       886       896      
           POLG_TMEVD   647 GSDNAEKGKVSNDDASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNIESTFVYQENDLRLNCLLLTPLPSFCPDSTSGPVKTKAPVQWRWVRSGGTTNFPLMTKQDYAFLCFSPFTYYKCDLEVTVSALGTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWLVGAGNTQISFVVPYNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSASVRIRYKKMKVFCPRPTLFFPWPV 902
               SCOP domains d1tme1_ 1: Theilovirus capsid proteins                                                                                                                                                                                                                           SCOP domains
               CATH domains 1tme100 1:1-256  [code=2.60.120.20, no name defined]                                                                                                                                                                                                             CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eehhhhh.......................hhhhhhh.....................ee..ee.eee.....ee..............ee..................hhhhhhh......................eeeeeee................hhhhh....eeeee..............................................eeeeee............................ Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tme 1   1 GSDNAEKGKVSNDDASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNIESTFVYQENDLRLNCLLLTPLPSFCPDSTSGPVKTKAPVQWRWVRSGGTTNFPLMTKQDYAFLCFSPFTYYKCDLEVTVSALGTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWLVGAGNTQISFVVPYNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSASVRIRYKKMKVFCPRPTLFFPWPV 256
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250      

Chain 2 from PDB  Type:PROTEIN  Length:255
 aligned with POLG_TMEVD | P13899 from UniProtKB/Swiss-Prot  Length:2301

    Alignment length:255
                                   168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408     
           POLG_TMEVD   159 DRVASDKAGNSATNTQSTVGRLCGYGEAHHGEHPASCADTATDKVLAAERYYTIDLASWTTTQEAFSHIRIPLPHVLAGEDGGVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGDMEPTDPFTMDTTWRAPQGAPTGYRYDSRTGFFAMNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNIAPTSSWTQHANWTLVVAVFSPLQYASGSSSDVQITASIQPVNPVFNGLRHETVIA 413
               SCOP domains d1tme.1 4:,2: Theilovirus capsid proteins                                                                                                                                                                                                                       SCOP domains
               CATH domains 1tme200 2:12-266  [code=2.60.120.20, no name defined]                                                                                                                                                                                                           CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeee..eeeee.....eee.hhh..............ee.hhhhh..eeeeeeee........eeeeeehhhhhhhhhhhhhhhhh.eeeeeeeeeeeee.......eeeeeeeeee......ee......ee.................................hhhhhhhh.eeeee.....eeeeee.........hhhh...eeeeeeeeeeee........eeeeeeeeeeeeeeeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tme 2  12 DRVASDKAGNSATNTQSTVGRLCGYGEAHHGEHPASCADTATDKVLAAERYYTIDLASWTTTQEAFSHIRIPLPHVLAGEDGGVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGDMEPTDPFTMDTTWRAPQGAPTGYRYDSRTGFFAMNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNIAPTSSWTQHANWTLVVAVFSPLQYASGSSSDVQITASIQPVNPVFNGLRHETVIA 266
                                    21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261     

Chain 3 from PDB  Type:PROTEIN  Length:230
 aligned with POLG_TMEVD | P13899 from UniProtKB/Swiss-Prot  Length:2301

    Alignment length:232
                                   424       434       444       454       464       474       484       494       504       514       524       534       544       554       564       574       584       594       604       614       624       634       644  
           POLG_TMEVD   415 SPIAVTVREHKGCFYSTNPDTTVPIYGKTISTPNDYMCGEFSDLLELCKLPTFLGNPNSNNKRYPYFSATNSVPTTSLVDYQVALSCSCMCNSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFLIAYTPPGAGKPTTRDQAMQATYAIWDLGLNSSFVFTAPFISPTHYRQTSYTSATIASVDGWVTVWQLTPLTYPSGAPVNSDILTLVSAGDDFTLRMPISPTKWAPQ 646
               SCOP domains d1tme3_ 3: Theilovirus capsid proteins                                                                                                                                                                                                   SCOP domains
               CATH domains 1tme300 3:1-232  [code=2.60.120.20, no name defined]                                                                                                                                                                                     CATH domains
           Pfam domains (1) ----------------------------Rhv-1tme301 3:29-232                                                                                                                                                                                         Pfam domains (1)
           Pfam domains (2) ----------------------------Rhv-1tme302 3:29-232                                                                                                                                                                                         Pfam domains (2)
         Sec.struct. author .............................ee...........hhhhhhhh.ee..ee.....ee.eeeee........eeee..........hhhhhhhh.eeeee..eeeeeee......eeeeeeeee........hhhhhh..eeeeee.....eeeeee........ee......--.....eeeeeeeeeee.......eeeeeeeeee....eeeee......... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tme 3   1 SPIAVTVREHKGCFYSTNPDTTVPIYGKTISTPNDYMCGEFSDLLELCKLPTFLGNPNSNNKRYPYFSATNSVPTTSLVDYQVALSCSCMCNSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFLIAYTPPGAGKPTTRDQAMQATYAIWDLGLNSSFVFTAPFISPTHYRQTSYTSA--ASVDGWVTVWQLTPLTYPSGTPVNSDILTLVSAGDDFTLRMPISPTKWVPQ 232
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170        |- |     190       200       210       220       230  
                                                                                                                                                                                                            179  |                                                  
                                                                                                                                                                                                               182                                                  

Chain 4 from PDB  Type:PROTEIN  Length:25
 aligned with POLG_TMEVD | P13899 from UniProtKB/Swiss-Prot  Length:2301

    Alignment length:25
                                    99       109     
           POLG_TMEVD    90 SGNEGVIINNFYSNQYQNSIDLSAS 114
               SCOP domains d1tme.1 4:,2:             SCOP domains
               CATH domains 1tme400 4:15-39           CATH domains
               Pfam domains VP4_2-1tme401 4:15-39     Pfam domains
         Sec.struct. author ............hhhhhh.ee.... Sec.struct. author
                 SAPs(SNPs) ------------------------- SAPs(SNPs)
                    PROSITE ------------------------- PROSITE
                 Transcript ------------------------- Transcript
                 1tme 4  15 SGNEGVIINNFYSNQYQNSIDLSAS  39
                                    24        34     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit

(-) CATH Domains  (2, 4)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 3)

Asymmetric Unit

(-) Gene Ontology  (46, 46)

Asymmetric Unit(hide GO term definitions)
Chain 1,2,3,4   (POLG_TMEVD | P13899)
molecular function
    GO:0005524    ATP binding    Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
    GO:0003724    RNA helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a RNA helix.
    GO:0003968    RNA-directed 5'-3' RNA polymerase activity    Catalysis of the reaction: nucleoside triphosphate + RNA(n) = diphosphate + RNA(n+1); uses an RNA template, i.e. the catalysis of RNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time.
    GO:0004197    cysteine-type endopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0008234    cysteine-type peptidase activity    Catalysis of the hydrolysis of peptide bonds in a polypeptide chain by a mechanism in which the sulfhydryl group of a cysteine residue at the active center acts as a nucleophile.
    GO:0004386    helicase activity    Catalysis of the reaction: NTP + H2O = NDP + phosphate, to drive the unwinding of a DNA or RNA helix.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0005216    ion channel activity    Enables the facilitated diffusion of an ion (by an energy-independent process) by passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism. May be either selective (it enables passage of a specific ion only) or non-selective (it enables passage of two or more ions of same charge but different size).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0017111    nucleoside-triphosphatase activity    Catalysis of the reaction: a nucleoside triphosphate + H2O = nucleoside diphosphate + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016779    nucleotidyltransferase activity    Catalysis of the transfer of a nucleotidyl group to a reactant.
    GO:0008233    peptidase activity    Catalysis of the hydrolysis of a peptide bond. A peptide bond is a covalent bond formed when the carbon atom from the carboxyl group of one amino acid shares electrons with the nitrogen atom from the amino group of a second amino acid.
    GO:0005198    structural molecule activity    The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0018144    RNA-protein covalent cross-linking    The formation of a covalent cross-link between RNA and a protein.
    GO:0030683    evasion or tolerance by virus of host immune response    Any process, either active or passive, by which a virus avoids the effects of the host organism's immune response. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0039520    induction by virus of host autophagy    Any process in which a virus activates or increases the frequency, rate or extent of autophagy in the host.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0039707    pore formation by virus in membrane of host cell    The aggregation, arrangement and bonding together of a set of components by a virus to form a pore complex in a membrane of a host organism.
    GO:0051259    protein oligomerization    The process of creating protein oligomers, compounds composed of a small number, usually between three and ten, of component monomers; protein oligomers may be composed of different or identical monomers. Oligomers may be formed by the polymerization of a number of monomers or the depolymerization of a large protein polymer.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0039548    suppression by virus of host IRF3 activity    Any process in which a virus stops, prevents, or reduces the activity of host IRF3 (interferon regulatory factor-3), a transcription factor in the RIG-I/MDA-5 signaling pathway. Viral infection triggers phosphorylation of cytoplasmic IRF3, which allows IRF3 to form a homodimer, migrate to the nucleus, and activate transcription of IFN-alpha and IFN-beta genes.
    GO:0039544    suppression by virus of host RIG-I activity by RIG-I proteolysis    The chemical reactions and pathways performed by a virus resulting in the hydrolysis of the host RIG-I protein (also known as DDX58) by cleavage of peptide bonds, thereby inhibiting RIG-I signal transduction.
    GO:0039657    suppression by virus of host gene expression    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of gene expression in the host organism. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Some protein processing events may be included when they are required to form an active form of a product from an inactive precursor form.
    GO:0039503    suppression by virus of host innate immune response    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of the innate immune response of the host organism, the host's first line of defense.
    GO:0039522    suppression by virus of host mRNA export from nucleus    Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of movement of mRNA from the nucleus to the cytoplasm in the host organism.
    GO:0006351    transcription, DNA-templated    The cellular synthesis of RNA on a template of DNA.
    GO:0001172    transcription, RNA-templated    The cellular synthesis of RNA on a template of RNA.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
    GO:0039694    viral RNA genome replication    The replication of a viral RNA genome.
    GO:0046718    viral entry into host cell    The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
    GO:0016032    viral process    A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
    GO:0019062    virion attachment to host cell    The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
    GO:0030430    host cell cytoplasm    The cytoplasm of a host cell.
    GO:0044161    host cell cytoplasmic vesicle    A vesicle formed of membrane or protein, found in the cytoplasm of a host cell.
    GO:0044162    host cell cytoplasmic vesicle membrane    The lipid bilayer surrounding a host cell cytoplasmic vesicle.
    GO:0033644    host cell membrane    Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0042025    host cell nucleus    A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.
    GO:0019030    icosahedral viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles; the subunits are arranged to form an icosahedron, a solid with 20 faces and 12 vertices. Icosahedral capsids have 12 pentamers plus 10(T-1) hexamers, where T is the triangulation number. Tobacco satellite necrosis virus has such a capsid structure.
    GO:0044385    integral to membrane of host cell    Penetrating at least one phospholipid bilayer of a membrane. May also refer to the state of being buried in the bilayer with no exposure outside the bilayer. When used to describe a protein, indicates that all or part of the peptide sequence is embedded in the membrane. Occurring in a host cell.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0019028    viral capsid    The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
    GO:0019012    virion    The complete fully infectious extracellular virus particle.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tme)
 
  Sites
(no "Sites" information available for 1tme)
 
  Cis Peptide Bonds
    Leu 2:84 - Pro 2:85   [ RasMol ]  
    Phe 1:104 - Pro 1:105   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tme
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  POLG_TMEVD | P13899
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  POLG_TMEVD | P13899
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        POLG_TMEVD | P138991tmf

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TME)