Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE XENOPUS TROPICALIS SPRED1 EVH-1 DOMAIN
 
Authors :  N. J. Harmer, J. Sivak, E. Amaya, T. L. Blundell
Date :  03 Jun 04  (Deposition) - 16 Aug 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Evh-1, Spred, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  N. J. Harmer, J. Sivak, E. Amaya, T. L. Blundell
1. 65A Crystal Structure Of The X. Tropicalis Spred1 Enabled/Vasodilator-Stimulated Phosphoprotein Homology-1 Domain
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - SPRED1
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PETG-10A
    Expression System Strain: ER2566 BL21 (DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: EVH-1 DOMAIN
    Gene: SPRED1
    Mutation: YES
    Organism Common: WESTERN CLAWED FROG
    Organism Scientific: XENOPUS TROPICALIS
    Organism Taxid: 8364

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TJ6)

(-) Sites  (0, 0)

(no "Site" information available for 1TJ6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1TJ6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TJ6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TJ6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1TJ6)

(-) Exons   (0, 0)

(no "Exon" information available for 1TJ6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:115
 aligned with SPRE1_XENTR | Q66JG9 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:115
                                    18        28        38        48        58        68        78        88        98       108       118     
          SPRE1_XENTR     9 DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG 123
               SCOP domains d1tj6a1 A:9-123 Sprouty-related, EVH1 domain-containing protein 1, Spred-1                                          SCOP domains
               CATH domains 1tj6A00 A:9-123 Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB)                         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeeeeee......eee.hhh..eeeeeee...........eeeeeee....eeeeeeee......eeee..eeeeee..eeeeeee.hhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                 1tj6 A   9 DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVILECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG 123
                                    18        28        38        48        58        68        78        88        98       108       118     


Chain B from PDB  Type:PROTEIN  Length:107
 aligned with SPRE1_XENTR | Q66JG9 from UniProtKB/Swiss-Prot  Length:406

    Alignment length:115
                                    18        28        38        48        58        68        78        88        98       108       118     
          SPRE1_XENTR     9 DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTLQPGDSGGTEFLVHGERLRDKTVVLECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG 123
               SCOP domains d1tj6b_ B: automated matches                                                                                        SCOP domains
               CATH domains 1tj6B00 B:9-123 Pleckstrin-homology d        omain (PH domain)/Phosphotyrosine-binding domain (PTB)                 CATH domains
           Pfam domains (1) WH1-1tj6B01 B:9-117                                                                                          ------ Pfam domains (1)
           Pfam domains (2) WH1-1tj6B02 B:9-117                                                                                          ------ Pfam domains (2)
         Sec.struct. author .eeeeeeeeeeee......eee.hhh..eeeeeee..--------.eeeeeee.....eeeeee.....eeeeee..eeeeee..eeeeeee.hhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------- Transcript
                 1tj6 B   9 DSYARVRAVVMTRDDSSGGWLQLGGGGLSSVTVSKTL--------EFLVHGERLRDKTVILECVLRRDLVYNKVTPTFHHWRIGDKKFGLTFQSPADARAFDRGIRRAIEDLSQG 123
                                    18        28        38      |  -     |  58        68        78        88        98       108       118     
                                                               45       54
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: PH (111)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (SPRE1_XENTR | Q66JG9)
molecular function
    GO:0019902    phosphatase binding    Interacting selectively and non-covalently with any phosphatase.
biological process
    GO:0007275    multicellular organism development    The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
    GO:0010923    negative regulation of phosphatase activity    Any process that decreases the rate or frequency of phosphatase activity. Phosphatases catalyze the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
    GO:0009966    regulation of signal transduction    Any process that modulates the frequency, rate or extent of signal transduction.
cellular component
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tj6)
 
  Sites
(no "Sites" information available for 1tj6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tj6)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tj6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SPRE1_XENTR | Q66JG9
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SPRE1_XENTR | Q66JG9
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        SPRE1_XENTR | Q66JG9: 1xod

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TJ6)