1TFP - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   TRANSTHYRETIN (FORMERLY KNOWN AS PREALBUMIN)

Authors :   M. Sunde, S. J. Richardson, L. Chang, T. M. Pettersson, G. Schreiber, C. C. F. Blake

Date :   05 Jan 96 (Deposition) - 10 Jun 96 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : A,B
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: A,B  (2x)

Keywords :   Transport (Thyroxine), Albumin, Retinol-Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. Sunde, S. J. Richardson, L. Chang, T. M. Pettersson, G. Schreiber, C. C. Blake
The Crystal Structure Of Transthyretin From Chicken.
Eur. J. Biochem. V. 236 491 1996
PubMed-ID: 8612621 | Reference-DOI: 10.1111/J.1432-1033.1996.00491.X
(for further references see the PDB file header)

Molecule 1 - TRANSTHYRETIN
	Chains	:	A, B
	Organism Common	:	CHICKEN
	Organism Scientific	:	GALLUS GALLUS
	Organism Taxid	:	9031
	Synonym	:	PREALBUMIN
	Tissue	:	SERUM

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (2x)	:	A	B

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 1 (1, 1)

No.	Name	Count	Type	Full Name
1	SO4	1	Ligand/Ion	SULFATE ION

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	SO4	2	Ligand/Ion	SULFATE ION

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER B:77	BINDING SITE FOR RESIDUE SO4 B 128

(no "SS Bond" information available for 1TFP)

(no "Cis Peptide Bond" information available for 1TFP)

(no "SAP(SNP)/Variant" information available for 1TFP)

Asymmetric Unit (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSTHYRETIN_1	PS00768	Transthyretin signature 1.	TTHY_CHICK	38-53	2	A:15-30 B:15-30
2	TRANSTHYRETIN_2	PS00769	Transthyretin signature 2.	TTHY_CHICK	128-140	2	A:105-117 B:105-117

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSTHYRETIN_1	PS00768	Transthyretin signature 1.	TTHY_CHICK	38-53	2	A:15-30 B:15-30
2	TRANSTHYRETIN_2	PS00769	Transthyretin signature 2.	TTHY_CHICK	128-140	2	A:105-117 B:105-117

Biological Unit 2 (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	TRANSTHYRETIN_1	PS00768	Transthyretin signature 1.	TTHY_CHICK	38-53	4	A:15-30 B:15-30
2	TRANSTHYRETIN_2	PS00769	Transthyretin signature 2.	TTHY_CHICK	128-140	4	A:105-117 B:105-117

(no "Exon" information available for 1TFP)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:114
 aligned with TTHY_CHICK | P27731 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:114
                                    42        52        62        72        82        92       102       112       122       132       142    
           TTHY_CHICK    33 CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS 146
               SCOP domains d1tfpa_ A: Transthyretin (synonym: prealbumin)                                                                     SCOP domains
               CATH domains 1tfpA00 A:10-123  [code=2.60.40.180, no name defined]                                                              CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee..........eeeeeee.....eeeeeeee..................eeeeeeee.....hhh.......eeeeeeee.......eeeeeee...eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----TRANSTHYRETIN_1 --------------------------------------------------------------------------TRANSTHYRETIN------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1tfp A  10 CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS 123
                                    19        29        39        49        59        69        79        89        99       109       119

Chain B from PDB  Type:PROTEIN  Length:114
 aligned with TTHY_CHICK | P27731 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:114
                                    42        52        62        72        82        92       102       112       122       132       142    
           TTHY_CHICK    33 CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS 146
               SCOP domains d1tfpb_ B: Transthyretin (synonym: prealbumin)                                                                     SCOP domains
               CATH domains 1tfpB00 B:10-123  [code=2.60.40.180, no name defined]                                                              CATH domains
           Pfam domains (1) Transthyretin-1tfpB01 B:10-121                                                                                  -- Pfam domains (1)
           Pfam domains (2) Transthyretin-1tfpB02 B:10-121                                                                                  -- Pfam domains (2)
         Sec.struct. author ..eeeeeee..........eeeeeee.....eeeeeeee..................eeeeeeee..............eeeeeeeee.......eeeeeee...eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE -----TRANSTHYRETIN_1 --------------------------------------------------------------------------TRANSTHYRETIN------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------ Transcript
                 1tfp B  10 CPLMVKVLDAVRGSPAANVAVKVFKKAADGTWQDFATGKTTEFGEIHELTTEEQFVEGVYRVEFDTSSYWKGLGLSPFHEYADVVFTANDSGHRHYTIAALLSPFSYSTTAVVS 123
                                    19        29        39        49        59        69        79        89        99       109       119

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Prealbumin-like (433)

Superfamily: Transthyretin (synonym: prealbumin) (211)

Family: Transthyretin (synonym: prealbumin) (198)

Protein domain: Transthyretin (synonym: prealbumin) (194)

Chicken (Gallus gallus) [TaxId: 9031] (1)

1a	d1tfpa_	A:
1b	d1tfpb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Sandwich (5577)

Topology: Immunoglobulin-like (3897)

Homologous Superfamily: [code=2.60.40.180, no name defined] (150)

Chicken (Gallus gallus) (1)

1a	1tfpA00	A:10-123
1b	1tfpB00	B:10-123

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Transthyretin (88)

Family: Transthyretin (45)

Gallus gallus (Chicken) (1)

1a	Transthyretin-1tfpB01	B:10-121
1b	Transthyretin-1tfpB02	B:10-121

Asymmetric Unit(hide GO term definitions)

Chain A,B (TTHY_CHICK | P27731)

molecular function
	GO:0005179	hormone activity	The action characteristic of a hormone, any substance formed in very small amounts in one specialized organ or group of cells and carried (sometimes in the bloodstream) to another organ or group of cells in the same organism, upon which it has a specific regulatory action. The term was originally applied to agents with a stimulatory physiological action in vertebrate animals (as opposed to a chalone, which has a depressant action). Usage is now extended to regulatory compounds in lower animals and plants, and to synthetic substances having comparable effects; all bind receptors and trigger some biological process.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019904	protein domain specific binding	Interacting selectively and non-covalently with a specific domain of a protein.
	GO:0036094	small molecule binding	Interacting selectively and non-covalently with a small molecule, any low molecular weight, monomeric, non-encoded molecule.
	GO:0070324	thyroid hormone binding	Interacting selectively and non-covalently with thyroxine (T4) or triiodothyronine (T3), tyrosine-based hormones produced by the thyroid gland.
biological process
	GO:0001555	oocyte growth	The developmental growth process in which an oocyte irreversibly increases in size over time by accretion and biosynthetic production of matter similar to that already present.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:0009615	response to virus	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from a virus.
	GO:0042572	retinol metabolic process	The chemical reactions and pathways involving retinol, one of the three compounds that makes up vitamin A.
	GO:0070327	thyroid hormone transport	The directed movement of thyroid hormone into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0030136	clathrin-coated vesicle	A vesicle with a coat formed of clathrin connected to the membrane via one of the clathrin adaptor complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0032991	macromolecular complex	A stable assembly of two or more macromolecules, i.e. proteins, nucleic acids, carbohydrates or lipids, in which at least one component is a protein and the constituent parts function together.
	GO:0060417	yolk	The cytoplasmic part that serves as a nutrient reserve or energy source for the developing embryo.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		SO4	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tfp)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1tfp
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TTHY_CHICK \| P27731
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TTHY_CHICK \| P27731
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1TFP)

(no "Related Entries Specified in the PDB File" available for 1TFP)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 4)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (18, 18)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File