Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  DIMERIZATION DOMAIN OF EF-TS FROM T. THERMOPHILUS
 
Authors :  Y. Jiang, S. Nock, M. Nesper, M. Sprinzl, P. B. Sigler
Date :  16 Apr 96  (Deposition) - 08 Nov 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Elongation Factor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Jiang, S. Nock, M. Nesper, M. Sprinzl, P. B. Sigler
Structure And Importance Of The Dimerization Domain In Elongation Factor Ts From Thermus Thermophilus.
Biochemistry V. 35 10269 1996
PubMed-ID: 8756682  |  Reference-DOI: 10.1021/BI960918W
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ELONGATION FACTOR TS
    Cell Line: BL21
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Gene: TSF
    Expression System Plasmid: PET28C
    Expression System Strain: BL21 (DE3)
    Expression System Taxid: 469008
    Fragment: EF-TS DIMERIZATION DOMAIN, RESIDUES 55 - 196
    Gene: TSF
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 274

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1TFE)

(-) Sites  (0, 0)

(no "Site" information available for 1TFE)

(-) SS Bonds  (1, 1)

Asymmetric Unit
No.Residues
1A:190 -A:190

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1TFE)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1TFE)

(-) PROSITE Motifs  (1, 1)

Asymmetric Unit (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_TS_2PS01127 Elongation factor Ts signature 2.EFTS_THET875-85  1A:75-85
Biological Unit 1 (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1EF_TS_2PS01127 Elongation factor Ts signature 2.EFTS_THET875-85  2A:75-85

(-) Exons   (0, 0)

(no "Exon" information available for 1TFE)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:142
 aligned with EFTS_THET8 | P43895 from UniProtKB/Swiss-Prot  Length:196

    Alignment length:142
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194  
           EFTS_THET8    55 AREGIIGHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSAEEIPAEELEKERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQQAIAKIGENIVVRRFCRFELGA 196
               SCOP domains d1tfea_ A: Elongation factor Ts (EF-Ts), dimerisation domain                                                                                   SCOP domains
               CATH domains 1tfeA01 A:55-109,A:155-196                             1tfeA02 A:110-154                            1tfeA01 A:55-109,A:155-196                 CATH domains
           Pfam domains (1) -----------------------------------EF_TS-1tfeA01 A:90-196                                                                                      Pfam domains (1)
           Pfam domains (2) -----------------------------------EF_TS-1tfeA02 A:90-196                                                                                      Pfam domains (2)
         Sec.struct. author ..eeeeeeee.....eeeeeeeee..hhhhh.hhhhhhhhhhhhhhhhh......hhh..hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh.hhh..........hhhhhhhhhhhh....eeeeeeeee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------EF_TS_2    --------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tfe A  55 AREGIIGHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSAEEIPAEELEKERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQQAIAKIGENIVVRRFCRFELGA 196
                                    64        74        84        94       104       114       124       134       144       154       164       174       184       194
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: EF_TS] (2)

(-) Gene Ontology  (5, 5)

Asymmetric Unit(hide GO term definitions)
Chain A   (EFTS_THET8 | P43895)
molecular function
    GO:0003746    translation elongation factor activity    Functions in chain elongation during polypeptide synthesis at the ribosome.
biological process
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006414    translational elongation    The successive addition of amino acid residues to a nascent polypeptide chain during protein biosynthesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1tfe)
 
  Sites
(no "Sites" information available for 1tfe)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1tfe)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1tfe
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  EFTS_THET8 | P43895
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  EFTS_THET8 | P43895
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        EFTS_THET8 | P43895: 1aip

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1TFE)