1TDF - JenaLib

Title :   CRYSTAL STRUCTURE OF ESCHERICHIA COLI THIOREDOXIN REDUCTASE REFINED AT 2 ANGSTROM RESOLUTION: IMPLICATIONS FOR A LARGE CONFORMATIONAL CHANGE DURING CATALYSIS

Authors :   G. Waksman, T. S. R. Krishna, C. H. Williams Junior, J. Kuriyan

Date :   14 Jan 94 (Deposition) - 30 Nov 94 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.30

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Oxidoreductase(Flavoenzyme) (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   G. Waksman, T. S. R. Krishna, C. H. Williams Jr. , J. Kuriyan
Crystal Structure Of Escherichia Coli Thioredoxin Reductase Refined At 2 A Resolution. Implications For A Large Conformational Change During Catalysis.
J. Mol. Biol. V. 236 800 1994
PubMed-ID: 8114095 | Reference-DOI: 10.1006/JMBI.1994.1190

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 2)

Sites (2, 2)

Asymmetric Unit (2, 2)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	GLY A:12 , SER A:13 , GLY A:14 , PRO A:15 , ALA A:16 , TYR A:23 , THR A:35 , GLY A:36 , MET A:37 , GLU A:38 , GLY A:41 , GLN A:42 , LEU A:43 , THR A:46 , VAL A:49 , ASN A:51 , HIS A:83 , ILE A:84 , ALA A:111 , THR A:112 , GLY A:113 , SER A:138 , GLY A:285 , ASP A:286 , ARG A:293 , GLN A:294 , ALA A:295 , SER A:298 , HOH A:602 , HOH A:605 , HOH A:607 , HOH A:613 , HOH A:615 , HOH A:617 , HOH A:623 , HOH A:675 , HOH A:767	BINDING SITE FOR RESIDUE FAD A 500
2	AC2	SOFTWARE	LEU A:119 , ILE A:151 , GLY A:153 , ASN A:155 , THR A:156 , GLU A:159 , HIS A:175 , ARG A:176 , ARG A:181 , GLU A:183 , GLN A:226 , ASN A:227 , ILE A:243 , GLY A:244 , ASN A:260 , TYR A:262 , HIS A:290 , ARG A:293 , HOH A:618 , HOH A:639 , HOH A:771 , HOH A:827	BINDING SITE FOR RESIDUE NAP A 481

SS Bonds (0, 0)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 1)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:316
 aligned with TRXB_ECOLI | P0A9P4 from UniProtKB/Swiss-Prot  Length:321

    Alignment length:316
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311      
           TRXB_ECOLI     2 GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL 317
               SCOP domains d1tdfa1 A:1-118,A:245-316 Thioredoxin reductase                                                                       d1tdfa2 A:119-244 Thioredoxin reductase                                                                                       d1tdfa1 A:1-118,A:245-316 Thioredoxin reductase                          SCOP domains
               CATH domains 1tdfA01 A:1-116,A:245-315  [code=3.50.50.60, no name defined]                                                       1tdfA02 A:117-244  [code=3.50.50.60, no name defined]                                                                           1tdfA01 A:1-116,A:245-315  [code=3.50.50.60, no name defined]          - CATH domains
           Pfam domains (1) --------------------------------------------------------------------------------------------------------------------------------------------------Pyr_redox-1tdfA01 A:147-228                                                       ---------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ------Pyr_redox_2-1tdfA02 A:7-292                                                                                                                                                                                                                                                                   ------------------------ Pfam domains (2)
         Sec.struct. author ..eeeeeeeee..hhhhhhhhhhhhh.....eee......hhhhhh.............hhhhhhhhhhhhhhhh..eee...eeeee.....eeeee...eeeeeeeee...eee....hhhhhhh....ee.hhhhhhhhhh..eeeee..hhhhhhhhhhhh....eeeeee.......hhhhhhhhhhhhhh..eeeee..eeeeeee....eeeeeee........eeee..eeee...eee.hhhhh....ee..ee.................eee.hhhh.....hhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------PYRIDINE_REDOX_2     ----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1tdf A   1 GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL 316
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (2, 2)

Gene Ontology (8, 8)

Asymmetric Unit(hide GO term definitions)

Chain A (TRXB_ECOLI | P0A9P4)

molecular function
	GO:0050660	flavin adenine dinucleotide binding	Interacting selectively and non-covalently with FAD, flavin-adenine dinucleotide, the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes, in either the oxidized form, FAD, or the reduced form, FADH2.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004791	thioredoxin-disulfide reductase activity	Catalysis of the reaction: NADP(+) + thioredoxin = H(+) + NADPH + thioredoxin disulfide.
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0019430	removal of superoxide radicals	Any process, acting at the cellular level, involved in removing superoxide radicals (O2-) from a cell or organism, e.g. by conversion to dioxygen (O2) and hydrogen peroxide (H2O2).
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		FAD	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		NAP	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Arg A:92 - Pro A:93	[ RasMol ]

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1tdf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TRXB_ECOLI \| P0A9P4
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.6.4.5
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description