Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL GENOMICS, A PROTEIN FROM SALMONELLA TYPHIMURIUM SIMILAR TO E. COLI ACYL CARRIER PROTEIN PHOSPHODIESTERASE
 
Authors :  R. Zhang, R. Wu, F. Collart, A. Joachimiak, Midwest Center For Structural Genomics (Mcsg)
Date :  03 May 04  (Deposition) - 03 Aug 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Acyl Carrier Protein Phosphodiesterase, Fmn, Alpha/Beta/Alpha Sandwich, Psi, Protein Structure Initiative, Midwest Center For Structural Genomics, Mcsg, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Zhang, R. Wu, F. Collart, A. Joachimiak
1. 4 A Crystal Structure Of A Protein From Salmonella Typhimurium Similar To E. Coli Acyl Carrier Protein Phosphodiesterase
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ACYL CARRIER PROTEIN PHOSPHODIESTERASE
    Atcc700720
    ChainsA, B
    EC Number3.1.4.14
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21
    Expression System PlasmidPDM68
    Expression System StrainBL21
    Expression System Taxid511693
    Expression System Vector TypePLASMID
    GeneACPD, STM1642, STY1427, T1545
    Organism ScientificSALMONELLA TYPHIMURIUM
    Organism Taxid602
    SynonymACP PHOSPHODIESTERASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
1FMN2Ligand/IonFLAVIN MONONUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:10 , LEU A:12 , SER A:16 , GLN A:17 , SER A:18 , PRO A:95 , MET A:96 , TYR A:97 , ASN A:98 , PHE A:99 , SER A:140 , ARG A:141 , GLY A:142 , GLY A:143 , HIS A:145 , HOH A:498 , HOH A:630 , LEU B:51 , ARG B:60BINDING SITE FOR RESIDUE FMN A 202
2AC2SOFTWARELEU A:51 , SER B:10 , SER B:16 , GLN B:17 , SER B:18 , PRO B:95 , MET B:96 , TYR B:97 , ASN B:98 , PHE B:99 , SER B:140 , ARG B:141 , GLY B:142 , GLY B:143 , HIS B:145 , HOH B:468BINDING SITE FOR RESIDUE FMN B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1T5B)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1T5B)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1T5B)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1T5B)

(-) Exons   (0, 0)

(no "Exon" information available for 1T5B)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:199
 aligned with AZOR_SALTY | P63462 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
           AZOR_SALTY     1 MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA 201
               SCOP domains d1t5ba_ A: ACP phosphodiesterase AcpD                                                                                                                                                                     SCOP domains
               CATH domains 1t5bA00 A:1-201  [code=3.40.50.360, no name defined]                                                                                                                                                      CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhhhhhhhhhhh...eeeeee.........hhhhhhhh.--....hhhhhhhhhhhhhhhhhhhhh.eeeee........hhhhhhhhhhhh.....eeee..eeee.....eeeeeee...........hhhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1t5b A   1 MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMR--DAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA 201
                                    10        20        30        40        50        60  |     70        80        90       100       110       120       130       140       150       160       170       180       190       200 
                                                                                      60 63                                                                                                                                          

Chain B from PDB  Type:PROTEIN  Length:198
 aligned with AZOR_SALTY | P63462 from UniProtKB/Swiss-Prot  Length:201

    Alignment length:201
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200 
           AZOR_SALTY     1 MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMRPGDAPLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA 201
               SCOP domains d1t5bb_ B: ACP phosphodiesterase AcpD                                                                                                                                                                     SCOP domains
               CATH domains 1t5bB00 B:1-201  [code=3.40.50.360, no name defined]                                                                                                                                                      CATH domains
           Pfam domains (1) -Flavodoxin_2-1t5bB01 B:2-198                                                                                                                                                                         --- Pfam domains (1)
           Pfam domains (2) -Flavodoxin_2-1t5bB02 B:2-198                                                                                                                                                                         --- Pfam domains (2)
         Sec.struct. author ..eeeeee...hhhhhhhhhhhhhhhhhhhhhh...eeeeee.........hhhhhhhh.---...hhhhhhhhhhhhhhhhhhhhh.eeeee........hhhhhhhhhhhh.....eeee..eeee.....eeeeeee...........hhhhhhhhhhhhh....eeeeee.hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1t5b B   1 MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITVRDLAANPVPVLDGELVGAMR---APLTPRQQDALALSDELIAELKAHDVIVIAAPMYNFNIPTQLKNYFDLIARAGITFRYTEKGPEGLVTGKRAVVLSSRGGIHKDTPTDLIAPYLKVFLGFIGITDVNFVFAEGIAYGPEVAAKAQADAKAAIDSVVAA 201
                                    10        20        30        40        50        60   |    70        80        90       100       110       120       130       140       150       160       170       180       190       200 
                                                                                      60  64                                                                                                                                         

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (AZOR_SALTY | P63462)
molecular function
    GO:0010181    FMN binding    Interacting selectively and non-covalently with flavin mono nucleotide. Flavin mono nucleotide (FMN) is the coenzyme or the prosthetic group of various flavoprotein oxidoreductase enzymes.
    GO:0008752    FMN reductase activity    Catalysis of the reaction: FMNH2 + NAD(P)+ = FMN + NAD(P)H + H+.
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016652    oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor    Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces NAD+ or NADP.
    GO:0016661    oxidoreductase activity, acting on other nitrogenous compounds as donors    Catalysis of an oxidation-reduction (redox) reaction in which a nitrogenous group, excluding NH and NH2 groups, acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    FMN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1t5b)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1t5b
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AZOR_SALTY | P63462
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.4.14
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  AZOR_SALTY | P63462
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1T5B)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1T5B)