Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  ARGINASE-DEHYDRO-ABH COMPLEX
 
Authors :  E. Cama, S. Pethe, J. -L. Boucher, S. Han, F. A. Emig, D. E. Ash, R. E. Viola, D. Mansuy, D. W. Christianson
Date :  30 Apr 04  (Deposition) - 12 Apr 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Arginase, Dehydro-Abh, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  E. Cama, S. Pethe, J. -L. Boucher, S. Han, F. A. Emig, D. E. Ash, R. E. Viola, D. Mansuy, D. W. Christianson
Inhibitor Coordination Interactions In The Binuclear Manganese Cluster Of Arginase
Biochemistry V. 43 8987 2004
PubMed-ID: 15248756  |  Reference-DOI: 10.1021/BI0491705
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ARGINASE 1
    Chains: A, B, C
    EC Number: 3.5.3.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: ARG1
    Organism Common: NORWAY RAT
    Organism Scientific: RATTUS NORVEGICUS
    Organism Taxid: 10116
    Synonym: LIVER-TYPE ARGINASE

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 9)

Asymmetric/Biological Unit (2, 9)
No.NameCountTypeFull Name
12BH3Ligand/Ion[(1E,5S)-5-AMINO-5-CARBOXYPENT-1-ENYL](TRIHYDROXY)BORATE(1-)
2MN6Ligand/IonMANGANESE (II) ION

(-) Sites  (9, 9)

Asymmetric Unit (9, 9)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP B:124 , HIS B:126 , ASP B:232 , ASP B:234 , MN B:501 , 2BH B:1001BINDING SITE FOR RESIDUE MN B 500
2AC2SOFTWAREHIS B:101 , ASP B:124 , ASP B:128 , ASP B:232 , MN B:500 , 2BH B:1001BINDING SITE FOR RESIDUE MN B 501
3AC3SOFTWAREHIS A:101 , ASP A:124 , ASP A:128 , ASP A:232 , MN A:504 , 2BH A:1000BINDING SITE FOR RESIDUE MN A 502
4AC4SOFTWAREHIS C:101 , ASP C:124 , ASP C:128 , ASP C:232 , MN C:505 , 2BH C:1002BINDING SITE FOR RESIDUE MN C 503
5AC5SOFTWAREASP A:124 , HIS A:126 , ASP A:232 , ASP A:234 , MN A:502 , 2BH A:1000BINDING SITE FOR RESIDUE MN A 504
6AC6SOFTWAREASP C:124 , HIS C:126 , ASP C:232 , ASP C:234 , MN C:503 , 2BH C:1002BINDING SITE FOR RESIDUE MN C 505
7AC7SOFTWAREHIS A:101 , ASP A:124 , HIS A:126 , ASP A:128 , ASN A:130 , SER A:137 , HIS A:141 , ASP A:183 , ASP A:232 , ASP A:234 , GLU A:277 , MN A:502 , MN A:504 , HOH A:776 , HOH A:787 , HOH A:788 , HOH A:789 , HOH A:802BINDING SITE FOR RESIDUE 2BH A 1000
8AC8SOFTWAREHIS B:101 , ASP B:124 , HIS B:126 , ASP B:128 , ASN B:130 , SER B:137 , HIS B:141 , ASP B:183 , ASP B:232 , ASP B:234 , GLU B:277 , MN B:500 , MN B:501 , HOH B:790 , HOH B:791 , HOH B:793BINDING SITE FOR RESIDUE 2BH B 1001
9AC9SOFTWAREHIS C:101 , ASP C:124 , HIS C:126 , ASP C:128 , ASN C:130 , SER C:137 , HIS C:141 , ASP C:183 , ASP C:232 , ASP C:234 , GLU C:277 , MN C:503 , MN C:505 , HOH C:774 , HOH C:783 , HOH C:803 , HOH C:804BINDING SITE FOR RESIDUE 2BH C 1002

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1T4P)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1T4P)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1T4P)

(-) PROSITE Motifs  (1, 3)

Asymmetric/Biological Unit (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ARGINASE_1PS01053 Arginase family signature.ARGI1_RAT230-251
 
 
  3A:230-251
B:230-251
C:230-251

(-) Exons   (8, 24)

Asymmetric/Biological Unit (8, 24)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSRNOT000000179111ENSRNOE00000127362chr1:20998894-20999025132ARGI1_RAT1-19193A:6-19
B:6-19
C:6-19
14
14
14
1.2ENSRNOT000000179112ENSRNOE00000127505chr1:21003810-2100388273ARGI1_RAT20-44253A:20-44
B:20-44
C:20-44
25
25
25
1.3ENSRNOT000000179113ENSRNOE00000127596chr1:21005814-21005988175ARGI1_RAT44-102593A:44-102
B:44-102
C:44-102
59
59
59
1.4ENSRNOT000000179114ENSRNOE00000126918chr1:21008032-21008191160ARGI1_RAT102-155543A:102-155
B:102-155
C:102-155
54
54
54
1.5ENSRNOT000000179115ENSRNOE00000126971chr1:21009513-2100960795ARGI1_RAT156-187323A:156-187
B:156-187
C:156-187
32
32
32
1.6ENSRNOT000000179116ENSRNOE00000127033chr1:21010045-21010149105ARGI1_RAT187-222363A:187-222
B:187-222
C:187-222
36
36
36
1.7ENSRNOT000000179117ENSRNOE00000127086chr1:21010337-21010473137ARGI1_RAT222-268473A:222-268
B:222-268
C:222-268
47
47
47
1.8ENSRNOT000000179118ENSRNOE00000127695chr1:21010716-21011266551ARGI1_RAT268-323563A:268-319
B:268-319
C:268-319
52
52
52

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:314
 aligned with ARGI1_RAT | P07824 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:314
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    
            ARGI1_RAT     6 KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL 319
               SCOP domains d1t4pa_ A: Arginase                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1t4pA00 A:6-319  [code=3.40.800.10, no name defined]                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.........hhhhhhhhhhhhhhhhhhhh...eeeeeee................hhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhh................hhh.eeee.....hhhhhhhhhhhh.eeehhhhhhhhhhhhhhhhhhhhhh......eeeeee.hhh................hhhhhhhhhhhhhhh..eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ARGINASE_1            -------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1      Exon 1.2  PDB: A:20-44   ---------------------------------------------------------Exon 1.4  PDB: A:102-155 UniProt: 102-155             Exon 1.5  PDB: A:156-187        ----------------------------------Exon 1.7  PDB: A:222-268 UniProt: 222-268      --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3  PDB: A:44-102 UniProt: 44-102                    ------------------------------------------------------------------------------------Exon 1.6  PDB: A:187-222            ---------------------------------------------Exon 1.8  PDB: A:268-319 UniProt: 268-323            Transcript 1 (2)
                 1t4p A   6 KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL 319
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    

Chain B from PDB  Type:PROTEIN  Length:314
 aligned with ARGI1_RAT | P07824 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:314
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    
            ARGI1_RAT     6 KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL 319
               SCOP domains d1t4pb_ B: Arginase                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1t4pB00 B:6-319  [code=3.40.800.10, no name defined]                                                                                                                                                                                                                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeee.........hhhhhhhhhhhhhhhhhhhh...eeeeeee................hhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhh................hhh.eeeeee...hhhhhhhhhhh..eeeehhhhhhhhhhhhhhhhhhhhh......eeeeee.hhh................hhhhhhhhhhhhhhh..eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ARGINASE_1            -------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1      Exon 1.2  PDB: B:20-44   ---------------------------------------------------------Exon 1.4  PDB: B:102-155 UniProt: 102-155             Exon 1.5  PDB: B:156-187        ----------------------------------Exon 1.7  PDB: B:222-268 UniProt: 222-268      --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3  PDB: B:44-102 UniProt: 44-102                    ------------------------------------------------------------------------------------Exon 1.6  PDB: B:187-222            ---------------------------------------------Exon 1.8  PDB: B:268-319 UniProt: 268-323            Transcript 1 (2)
                 1t4p B   6 KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL 319
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    

Chain C from PDB  Type:PROTEIN  Length:314
 aligned with ARGI1_RAT | P07824 from UniProtKB/Swiss-Prot  Length:323

    Alignment length:314
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    
            ARGI1_RAT     6 KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL 319
               SCOP domains d1t4pc_ C: Arginase                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1t4pC00 C:6-319  [code=3.40.800.10, no name defined]                                                                                                                                                                                                                                                                       CATH domains
           Pfam domains (1) Arginase-1t4pC01 C:6-305                                                                                                                                                                                                                                                                                    -------------- Pfam domains (1)
           Pfam domains (2) Arginase-1t4pC02 C:6-305                                                                                                                                                                                                                                                                                    -------------- Pfam domains (2)
           Pfam domains (3) Arginase-1t4pC03 C:6-305                                                                                                                                                                                                                                                                                    -------------- Pfam domains (3)
         Sec.struct. author .eeeeeee.........hhhhhhhhhhhhhhhhhhhh...eeeeeee................hhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh...eeeee...............hhhhhhhhhhhhhhh................hhh.eeeeee...hhhhhhhhhhhh.eeeehhhhhhhhhhhhhhhhhhhhh......eeeeee.hhh................hhhhhhhhhhhhhhh..eeeeeee..hhhhh.hhhhhhhhhhhhhhhhhhhh............... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ARGINASE_1            -------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1      Exon 1.2  PDB: C:20-44   ---------------------------------------------------------Exon 1.4  PDB: C:102-155 UniProt: 102-155             Exon 1.5  PDB: C:156-187        ----------------------------------Exon 1.7  PDB: C:222-268 UniProt: 222-268      --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------Exon 1.3  PDB: C:44-102 UniProt: 44-102                    ------------------------------------------------------------------------------------Exon 1.6  PDB: C:187-222            ---------------------------------------------Exon 1.8  PDB: C:268-319 UniProt: 268-323            Transcript 1 (2)
                 1t4p C   6 KPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYL 319
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295       305       315    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 3)

Asymmetric/Biological Unit
(-)
Clan: Arginase (56)

(-) Gene Ontology  (47, 47)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C   (ARGI1_RAT | P07824)
molecular function
    GO:0004053    arginase activity    Catalysis of the reaction: L-arginine + H2O = L-ornithine + urea.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016813    hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines    Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amidine, a compound of the form R-C(=NH)-NH2.
    GO:0030145    manganese ion binding    Interacting selectively and non-covalently with manganese (Mn) ions.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0007568    aging    A developmental process that is a deterioration and loss of function over time. Aging includes loss of functions such as resistance to disease, homeostasis, and fertility, as well as wear and tear. Aging includes cellular senescence, but is more inclusive. May precede death and may succeed developmental maturation (GO:0021700).
    GO:0019547    arginine catabolic process to ornithine    The chemical reactions and pathways resulting in the breakdown of arginine into other compounds, including ornithine.
    GO:0006525    arginine metabolic process    The chemical reactions and pathways involving arginine, 2-amino-5-(carbamimidamido)pentanoic acid.
    GO:0071549    cellular response to dexamethasone stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a dexamethasone stimulus.
    GO:0071377    cellular response to glucagon stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a glucagon stimulus.
    GO:0070301    cellular response to hydrogen peroxide    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
    GO:0071353    cellular response to interleukin-4    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an interleukin-4 stimulus.
    GO:0071222    cellular response to lipopolysaccharide    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0071560    cellular response to transforming growth factor beta stimulus    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a transforming growth factor beta stimulus.
    GO:0032964    collagen biosynthetic process    The chemical reactions and pathways resulting in the formation of collagen, any of a group of fibrous proteins of very high tensile strength that form the main component of connective tissue in animals. Collagen is highly enriched in glycine (some regions are 33% glycine) and proline, occurring predominantly as 3-hydroxyproline (about 20%).
    GO:0007565    female pregnancy    The set of physiological processes that allow an embryo or foetus to develop within the body of a female animal. It covers the time from fertilization of a female ovum by a male spermatozoon until birth.
    GO:0001889    liver development    The process whose specific outcome is the progression of the liver over time, from its formation to the mature structure. The liver is an exocrine gland which secretes bile and functions in metabolism of protein and carbohydrate and fat, synthesizes substances involved in the clotting of the blood, synthesizes vitamin A, detoxifies poisonous substances, stores glycogen, and breaks down worn-out erythrocytes.
    GO:0030324    lung development    The process whose specific outcome is the progression of the lung over time, from its formation to the mature structure. In all air-breathing vertebrates the lungs are developed from the ventral wall of the oesophagus as a pouch which divides into two sacs. In amphibians and many reptiles the lungs retain very nearly this primitive sac-like character, but in the higher forms the connection with the esophagus becomes elongated into the windpipe and the inner walls of the sacs become more and more divided, until, in the mammals, the air spaces become minutely divided into tubes ending in small air cells, in the walls of which the blood circulates in a fine network of capillaries. In mammals the lungs are more or less divided into lobes, and each lung occupies a separate cavity in the thorax.
    GO:0060056    mammary gland involution    The tissue remodeling that removes differentiated mammary epithelia during weaning.
    GO:0060135    maternal process involved in female pregnancy    A reproductive process occurring in the mother that allows an embryo or fetus to develop within it.
    GO:0001938    positive regulation of endothelial cell proliferation    Any process that activates or increases the rate or extent of endothelial cell proliferation.
    GO:0070207    protein homotrimerization    The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
    GO:0010963    regulation of L-arginine import    Any process that modulates the frequency, rate or extent of L-arginine import. L-arginine import is the directed movement of L-arginine, the L-enantiomer of 2-amino-5-guanidinopentanoic acid, into a cell or organelle.
    GO:0014075    response to amine    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amine stimulus. An amine is a compound formally derived from ammonia by replacing one, two or three hydrogen atoms by hydrocarbyl groups.
    GO:0043200    response to amino acid    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an amino acid stimulus. An amino acid is a carboxylic acids containing one or more amino groups.
    GO:0048678    response to axon injury    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an axon injury stimulus.
    GO:0046686    response to cadmium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a cadmium (Cd) ion stimulus.
    GO:0042493    response to drug    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a drug stimulus. A drug is a substance used in the diagnosis, treatment or prevention of a disease.
    GO:0009635    response to herbicide    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a herbicide stimulus. Herbicides are chemicals used to kill or control the growth of plants.
    GO:0032496    response to lipopolysaccharide    Any process that results in a change in state or activity of an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a lipopolysaccharide stimulus; lipopolysaccharide is a major component of the cell wall of gram-negative bacteria.
    GO:0010042    response to manganese ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a manganese ion stimulus.
    GO:0051597    response to methylmercury    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a methylmercury stimulus.
    GO:0043434    response to peptide hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a peptide hormone stimulus. A peptide hormone is any of a class of peptides that are secreted into the blood stream and have endocrine functions in living animals.
    GO:0010269    response to selenium ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus from selenium ion.
    GO:0048545    response to steroid hormone    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a steroid hormone stimulus.
    GO:0033189    response to vitamin A    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin A stimulus.
    GO:0033197    response to vitamin E    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a vitamin E stimulus.
    GO:0009611    response to wounding    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to the organism.
    GO:0010043    response to zinc ion    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a zinc ion stimulus.
    GO:0000050    urea cycle    The sequence of reactions by which arginine is synthesized from ornithine, then cleaved to yield urea and regenerate ornithine. The overall reaction equation is NH3 + CO2 + aspartate + 3 ATP + 2 H2O = urea + fumarate + 2 ADP + 2 phosphate + AMP + diphosphate.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005615    extracellular space    That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
    GO:0005741    mitochondrial outer membrane    The outer, i.e. cytoplasm-facing, lipid bilayer of the mitochondrial envelope.
    GO:0043005    neuron projection    A prolongation or process extending from a nerve cell, e.g. an axon or dendrite.
    GO:0043025    neuronal cell body    The portion of a neuron that includes the nucleus, but excludes cell projections such as axons and dendrites.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    2BH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1t4p)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1t4p
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ARGI1_RAT | P07824
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.5.3.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ARGI1_RAT | P07824
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ARGI1_RAT | P07824: 1d3v 1hq5 1hqf 1hqg 1hqh 1hqx 1p8m 1p8n 1p8o 1p8p 1p8q 1p8r 1p8s 1r1o 1rla 1t4r 1t4s 1t4t 1t5f 1t5g 1ta1 1tbh 1tbj 1tbl 1zpe 1zpg 2rla 3e8q 3e8z 3e9b 3rla 4rla 5rla

(-) Related Entries Specified in the PDB File

1d3v ARGINASE-ABH COMPLEX
1t4r ARGINASE-DESCARBOXY-NOR-NOHA COMPLEX
1t4s ARGINASE-L-VALINE COMPLEX
1t4t ARGINASE-DINOR-NOHA COMPLEX
1t5f ARGINASE I-AOH COMPLEX
1t5g ARGINASE-F2-L-ARGININE COMPLEX