![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 1)
|
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 1T2T) |
(no "Cis Peptide Bond" information available for 1T2T) |
(no "SAP(SNP)/Variant" information available for 1T2T) |
(no "PROSITE Motif" information available for 1T2T) |
(no "Exon" information available for 1T2T) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:96 aligned with TEV1_BPT4 | P13299 from UniProtKB/Swiss-Prot Length:245 Alignment length:96 158 168 178 188 198 208 218 228 238 TEV1_BPT4 149 KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKKPSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN 244 SCOP domains d1t2ta_ A: DNA-binding domain of intron endonuclease I-TevI SCOP domains CATH domains ------------------------------------------------------------------------------------------------ CATH domains Pfam domains -----------------------------NUMOD3-1t2tA01 A:178-205 --------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 1t2t A 149 KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKKPSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN 244 158 168 178 188 198 208 218 228 238 Chain B from PDB Type:DNA Length:21 1t2t B 1 TTTGTAGGACTGCCCTTTAAT 21 10 20 Chain C from PDB Type:DNA Length:21 1t2t C 31 AATTAAAGGGCAGTCCTACAA 51 40 50
|
Asymmetric/Biological Unit |
(no "CATH Domain" information available for 1T2T) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (TEV1_BPT4 | P13299)
|
|
|
|
|
|
|