1SYX - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   THE CRYSTAL STRUCTURE OF A BINARY U5 SNRNP COMPLEX

Authors :   T. K. Nielsen, S. Liu, R. Luhrmann, R. Ficner

Date :   02 Apr 04 (Deposition) - 18 Oct 05 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.35

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: E,F  (1x)

Keywords :   Gyf-Domain; Thioredoxin-Like; Spliceosomal Proteins, Translation- Immune System Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   T. K. Nielsen, S. Liu, R. Luhrmann, R. Ficner
Structural Basis For The Bifunctionality Of The U5 Snrnp 52 Protein (Cd2Bp2).
J. Mol. Biol. V. 369 902 2007
PubMed-ID: 17467737 | Reference-DOI: 10.1016/J.JMB.2007.03.077

Molecule 1 - SPLICEOSOMAL U5 SNRNP-SPECIFIC 15 KDA PROTEIN
	Chains	:	A, C, E
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PXC35-15K
	Expression System Strain	:	TAP106
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	U5-15KD
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	U5-15KD

Molecule 2 - CD2 ANTIGEN CYTOPLASMIC TAIL-BINDING PROTEIN 2
	Chains	:	B, D, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3)RP
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	86 AMINO ACID C-TERMINAL FRAGMENT
	Gene	:	CD2BP2
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CD2BP2

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:					E	F

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1SYX)

(no "Site" information available for 1SYX)

(no "SS Bond" information available for 1SYX)

Asymmetric Unit

No.	Residues
1	Asp B:68	-	Pro B:69
2	Asp D:68	-	Pro D:69
3	Asp F:68	-	Pro F:69

(no "SAP(SNP)/Variant" information available for 1SYX)

Asymmetric Unit (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GYF	PS50829	GYF domain profile.	CD2B2_HUMAN	280-338	3	B:25-83 D:25-83 F:25-83

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GYF	PS50829	GYF domain profile.	CD2B2_HUMAN	280-338	1	B:25-83 - -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GYF	PS50829	GYF domain profile.	CD2B2_HUMAN	280-338	1	- D:25-83 -

Biological Unit 3 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	GYF	PS50829	GYF domain profile.	CD2B2_HUMAN	280-338	1	- - F:25-83

Asymmetric Unit (5, 15)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000269601	1a	ENSE00001274525	chr18:77748532-77748240	293	TXN4A_HUMAN	1-51	51	3	A:3-51 C:3-51 E:3-51	49 49 49
1.2	ENST00000269601	2	ENSE00000950773	chr18:77737701-77737598	104	TXN4A_HUMAN	52-86	35	3	A:52-86 C:52-86 E:52-86	35 35 35
1.4	ENST00000269601	4	ENSE00000996738	chr18:77733856-77732869	988	TXN4A_HUMAN	86-142	57	3	A:86-137 C:86-137 E:86-137	52 52 52

2.1	ENST00000305596	1	ENSE00001389090	chr16:30366682-30366533	150	CD2B2_HUMAN	-	0	0	-	-
2.2	ENST00000305596	2	ENSE00001328785	chr16:30366028-30365925	104	CD2B2_HUMAN	1-26	26	0	-	-
2.3	ENST00000305596	3	ENSE00001139812	chr16:30365643-30365505	139	CD2B2_HUMAN	27-73	47	0	-	-
2.4	ENST00000305596	4	ENSE00001139805	chr16:30365379-30365222	158	CD2B2_HUMAN	73-125	53	0	-	-
2.5	ENST00000305596	5	ENSE00001139799	chr16:30365121-30364689	433	CD2B2_HUMAN	126-270	145	0	-	-
2.6	ENST00000305596	6	ENSE00001139794	chr16:30364608-30364502	107	CD2B2_HUMAN	270-305	36	3	B:25-50 D:25-50 F:25-50	26 26 26
2.7	ENST00000305596	7	ENSE00001316361	chr16:30364416-30362087	2330	CD2B2_HUMAN	306-341	36	3	B:51-86 D:51-86 F:51-86	36 36 36

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:135
 aligned with TXN4A_HUMAN | P83876 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:135
                                    12        22        32        42        52        62        72        82        92       102       112       122       132     
          TXN4A_HUMAN     3 YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
               SCOP domains d1syxa_ A: spliceosomal protein U5-15Kd                                                                                                 SCOP domains
               CATH domains 1syxA00 A:3-137 Glutaredoxin                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....ee.hhhhhhhhhhh....eeeeeee...hhhhhhhhhhhhhhh......eeeeeee...hhhhhhhhh.....eeeeee..eeeeee..............hhhhhhhhhhhhhhhhhh...eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: A:3-51 UniProt: 1-51 [INCOMPLETE]Exon 1.2  PDB: A:52-86             --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------Exon 1.4  PDB: A:86-137 UniProt: 86-142 [INCOMPLETE] Transcript 1 (2)
                 1syx A   3 YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
                                    12        22        32        42        52        62        72        82        92       102       112       122       132

Chain B from PDB  Type:PROTEIN  Length:62
 aligned with CD2B2_HUMAN | O95400 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:62
                                   289       299       309       319       329       339  
          CD2B2_HUMAN   280 DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
               SCOP domains d1syxb_ B: GYF domain from cd2bp2 protein                      SCOP domains
               CATH domains 1syxB00 B:25-86  [code=3.30.1490.40, no name defined]          CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.........eeeeehhhhhhhhhh.......eeee........ee.hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GYF  PDB: B:25-83 UniProt: 280-338                         --- PROSITE
               Transcript 2 Exon 2.6  PDB: B:25-50    Exon 2.7  PDB: B:51-86               Transcript 2
                 1syx B  25 DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT  86
                                    34        44        54        64        74        84

Chain C from PDB  Type:PROTEIN  Length:135
 aligned with TXN4A_HUMAN | P83876 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:135
                                    12        22        32        42        52        62        72        82        92       102       112       122       132     
          TXN4A_HUMAN     3 YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
               SCOP domains d1syxc_ C: spliceosomal protein U5-15Kd                                                                                                 SCOP domains
               CATH domains 1syxC00 C:3-137 Glutaredoxin                                                                                                            CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhhhhhhhh....eeeeeee...hhhhhhhhhhhhhhhhhhh..eeeeeee......hhhhhh.....eeeeee..eeeeee..............hhhhhhhhhhhhhhhhhh...eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: C:3-51 UniProt: 1-51 [INCOMPLETE]Exon 1.2  PDB: C:52-86             --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------Exon 1.4  PDB: C:86-137 UniProt: 86-142 [INCOMPLETE] Transcript 1 (2)
                 1syx C   3 YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
                                    12        22        32        42        52        62        72        82        92       102       112       122       132

Chain D from PDB  Type:PROTEIN  Length:62
 aligned with CD2B2_HUMAN | O95400 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:62
                                   289       299       309       319       329       339  
          CD2B2_HUMAN   280 DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
               SCOP domains d1syxd_ D: GYF domain from cd2bp2 protein                      SCOP domains
               CATH domains 1syxD00 D:25-86  [code=3.30.1490.40, no name defined]          CATH domains
               Pfam domains -------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee.........eeeeehhhhhhhhh........eeee........ee.hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GYF  PDB: D:25-83 UniProt: 280-338                         --- PROSITE
               Transcript 2 Exon 2.6  PDB: D:25-50    Exon 2.7  PDB: D:51-86               Transcript 2
                 1syx D  25 DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT  86
                                    34        44        54        64        74        84

Chain E from PDB  Type:PROTEIN  Length:135
 aligned with TXN4A_HUMAN | P83876 from UniProtKB/Swiss-Prot  Length:142

    Alignment length:135
                                    12        22        32        42        52        62        72        82        92       102       112       122       132     
          TXN4A_HUMAN     3 YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
               SCOP domains d1syxe_ E: spliceosomal protein U5-15Kd                                                                                                 SCOP domains
               CATH domains 1syxE00 E:3-137 Glutaredoxin                                                                                                            CATH domains
           Pfam domains (1) -DIM1-1syxE01 E:4-136                                                                                                                 - Pfam domains (1)
           Pfam domains (2) -DIM1-1syxE02 E:4-136                                                                                                                 - Pfam domains (2)
           Pfam domains (3) -DIM1-1syxE03 E:4-136                                                                                                                 - Pfam domains (3)
         Sec.struct. author ....ee.hhhhhhhhhhh....eeeeeee...hhhhhhhhhhhhhhh......eeeeeee...hhhhhhhhh.....eeeeee..eeeeee..............hhhhhhhhhhhhhhhhhh...eee...... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: E:3-51 UniProt: 1-51 [INCOMPLETE]Exon 1.2  PDB: E:52-86             --------------------------------------------------- Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------------------------Exon 1.4  PDB: E:86-137 UniProt: 86-142 [INCOMPLETE] Transcript 1 (2)
                 1syx E   3 YMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYS 137
                                    12        22        32        42        52        62        72        82        92       102       112       122       132

Chain F from PDB  Type:PROTEIN  Length:62
 aligned with CD2B2_HUMAN | O95400 from UniProtKB/Swiss-Prot  Length:341

    Alignment length:62
                                   289       299       309       319       329       339  
          CD2B2_HUMAN   280 DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT 341
               SCOP domains d1syxf_ F: GYF domain from cd2bp2 protein                      SCOP domains
               CATH domains 1syxF00 F:25-86  [code=3.30.1490.40, no name defined]          CATH domains
           Pfam domains (1) -GYF-1syxF01 F:26-83                                       --- Pfam domains (1)
           Pfam domains (2) -GYF-1syxF02 F:26-83                                       --- Pfam domains (2)
           Pfam domains (3) -GYF-1syxF03 F:26-83                                       --- Pfam domains (3)
         Sec.struct. author ..eeeee.........eeeeehhhhhhhhhh.......eeee........ee.hhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------- SAPs(SNPs)
                    PROSITE GYF  PDB: F:25-83 UniProt: 280-338                         --- PROSITE
               Transcript 2 Exon 2.6  PDB: F:25-50    Exon 2.7  PDB: F:51-86               Transcript 2
                 1syx F  25 DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT  86
                                    34        44        54        64        74        84

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Dna Ligase; domain 1 (375)

Homologous Superfamily: [code=3.30.1490.40, no name defined] (3)

Human (Homo sapiens) (3)

1a	1syxB00	B:25-86
1b	1syxD00	D:25-86
1c	1syxF00	F:25-86

Architecture: 3-Layer(aba) Sandwich (12045)

Topology: Glutaredoxin (620)

Homologous Superfamily: Glutaredoxin (617)

Human (Homo sapiens) (186)

2a	1syxA00	A:3-137
2b	1syxC00	C:3-137
2c	1syxE00	E:3-137

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Thioredoxin (367)

Family: DIM1 (3)

Homo sapiens (Human) (3)

1a	DIM1-1syxE01	E:4-136
1b	DIM1-1syxE02	E:4-136
1c	DIM1-1syxE03	E:4-136

Clan: no clan defined [family: GYF] (4)

Family: GYF (4)

Homo sapiens (Human) (2)

2a	GYF-1syxF01	F:26-83
2b	GYF-1syxF02	F:26-83
2c	GYF-1syxF03	F:26-83

Asymmetric Unit(hide GO term definitions)

Chain A,C,E (TXN4A_HUMAN | P83876)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0000375	RNA splicing, via transesterification reactions	Splicing of RNA via a series of two transesterification reactions.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0000245	spliceosomal complex assembly	The aggregation, arrangement and bonding together of a spliceosomal complex, a ribonucleoprotein apparatus that catalyzes nuclear mRNA splicing via transesterification reactions.
cellular component
	GO:0046540	U4/U6 x U5 tri-snRNP complex	A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
	GO:0005682	U5 snRNP	A ribonucleoprotein complex that contains small nuclear RNA U5.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0005681	spliceosomal complex	Any of a series of ribonucleoprotein complexes that contain snRNA(s) and small nuclear ribonucleoproteins (snRNPs), and are formed sequentially during the spliceosomal splicing of one or more substrate RNAs, and which also contain the RNA substrate(s) from the initial target RNAs of splicing, the splicing intermediate RNA(s), to the final RNA products. During cis-splicing, the initial target RNA is a single, contiguous RNA transcript, whether mRNA, snoRNA, etc., and the released products are a spliced RNA and an excised intron, generally as a lariat structure. During trans-splicing, there are two initial substrate RNAs, the spliced leader RNA and a pre-mRNA.

Chain B,D,F (CD2B2_HUMAN | O95400)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0043021	ribonucleoprotein complex binding	Interacting selectively and non-covalently with any complex of RNA and protein.
biological process
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0006397	mRNA processing	Any process involved in the conversion of a primary mRNA transcript into one or more mature mRNA(s) prior to translation into polypeptide.
	GO:0000398	mRNA splicing, via spliceosome	The joining together of exons from one or more primary transcripts of messenger RNA (mRNA) and the excision of intron sequences, via a spliceosomal mechanism, so that mRNA consisting only of the joined exons is produced.
	GO:0010923	negative regulation of phosphatase activity	Any process that decreases the rate or frequency of phosphatase activity. Phosphatases catalyze the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
	GO:0000244	spliceosomal tri-snRNP complex assembly	The formation of a tri-snRNP complex containing U4 and U6 (or U4atac and U6atac) snRNAs and U5 snRNAs and associated proteins. This includes reannealing of U4 and U6 (or U4atac and U6atac) snRNAs released from previous rounds of splicing to reform the U4/U6 snRNP (or U4atac/U6atac snRNP) as well as the subsequent association of the U5 snRNP with the U4/U6 snRNP (or U4atac/U6atac snRNP) to form a tri-snRNP that is ready to reassemble into another spliceosome complex.
cellular component
	GO:0046540	U4/U6 x U5 tri-snRNP complex	A ribonucleoprotein complex formed by the association of the U4/U6 and U5 small nuclear ribonucleoproteins.
	GO:0005682	U5 snRNP	A ribonucleoprotein complex that contains small nuclear RNA U5.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0016607	nuclear speck	A discrete extra-nucleolar subnuclear domain, 20-50 in number, in which splicing factors are seen to be localized by immunofluorescence microscopy.
	GO:0005654	nucleoplasm	That part of the nuclear content other than the chromosomes or the nucleolus.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1syx)

	Sites
(no "Sites" information available for 1syx)

	Cis Peptide Bonds
		Asp B:68 - Pro B:69	[ RasMol ]
		Asp D:68 - Pro D:69	[ RasMol ]
		Asp F:68 - Pro F:69	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1syx
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CD2B2_HUMAN \| O95400
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	TXN4A_HUMAN \| P83876
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CD2B2_HUMAN \| O95400
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	TXN4A_HUMAN \| P83876
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CD2B2_HUMAN \| O95400	:	1gyf 1l2z 4bws
	TXN4A_HUMAN \| P83876	:	1pqn 1qgv 3jcr 4bwq 4bws 4cdo

1gyf	THE NMR STRUCTURE OF THE OTHER COMPONENT
1qgv	THE CRYSTAL STRUCTURE OF ONE OF THE COMPONENTS

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (3, 3)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 3)

Exons (5, 15)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 6)

CATH Domains (2, 6)

Pfam Domains (2, 6)

Gene Ontology (18, 26)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File