|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1SQE) |
(no "Site" information available for 1SQE) |
(no "SS Bond" information available for 1SQE) |
(no "Cis Peptide Bond" information available for 1SQE) |
(no "SAP(SNP)/Variant" information available for 1SQE) |
Asymmetric/Biological Unit (1, 2)
|
(no "Exon" information available for 1SQE) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:101 aligned with HDOX2_STAAM | Q99X56 from UniProtKB/Swiss-Prot Length:108 Alignment length:109 1 | 9 19 29 39 49 59 69 79 89 99 HDOX2_STAAM - -MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK 108 SCOP domains d1sqea_ A: Hypothetical protein PG130 (SAV0165) SCOP domains CATH domains 1sqeA00 A:16-124 [code=3.30.70.900, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --ABM PDB: A:18-109 UniProt: 2-93 --------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 1sqe A 16 HMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAH--------DDGQQSPILSNKVFKYDIGYHYQK 124 25 35 45 55 65 75 85 | - | 105 115 92 101 Chain B from PDB Type:PROTEIN Length:106 aligned with HDOX2_STAAM | Q99X56 from UniProtKB/Swiss-Prot Length:108 Alignment length:109 1 | 9 19 29 39 49 59 69 79 89 99 HDOX2_STAAM - -MFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEAHKNVRLKSDDDGQQSPILSNKVFKYDIGYHYQK 108 SCOP domains d1sqeb_ B: Hypothetical protein PG130 (SAV0165) SCOP domains CATH domains 1sqeB00 B:16-124 [code=3.30.70.900, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --ABM PDB: B:18-109 UniProt: 2-93 --------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------- Transcript 1sqe B 16 HMFMAENRLQLQKGSAEETIERFYNRQGIETIEGFQQMFVTKTLNTEDTDEVKILTIWESEDSFNNWLNSDVFKEA---VRLKSDDDGQQSPILSNKVFKYDIGYHYQK 124 25 35 45 55 65 75 85 | 95 105 115 91 95
|
Asymmetric/Biological Unit |
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 1SQE) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (HDOX2_STAAM | Q99X56)
|
|
|
|
|
|
|