|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 5) Biological Unit 1 (3, 10) |
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 1SPG) |
(no "Cis Peptide Bond" information available for 1SPG) |
(no "SAP(SNP)/Variant" information available for 1SPG) |
Asymmetric Unit (1, 2) Biological Unit 1 (1, 4) |
(no "Exon" information available for 1SPG) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:144 aligned with HBA_LEIXA | P56250 from UniProtKB/Swiss-Prot Length:143 Alignment length:144 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 HBA_LEIXA - -SLSATDKARVKALWDKIEGKSAELGAEALGRMLVSFPQTKIYFSEWGQDLGPQTPQVRNHGAVIMAAVGKAVKSIDNLVGGLSQLSELHAFKLRVDPANFKILAHNIILVISMYFPGDFTPEVHLSVDKFLACLALALSEKYR 143 SCOP domains d1spga_ A: Hemoglobin, alpha-chain SCOP domains CATH domains -1spgA00 A:1-143 Globins CATH domains Pfam domains ------Globin-1spgA01 A:6-108 ----------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE --GLOBIN PDB: A:2-143 UniProt: 2-143 PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1spg A 0 xSLSATDKARVKALWDKIEGKSAELGAEALGRMLVSFPQTKIYFSEWGQDLGPQTPQVRNHGAVIMAAVGKAVKSIDNLVGGLSQLSELHAFKLRVDPANFKILAHNIILVISMYFPGDFTPEVHLSVDKFLACLALALSEKYR 143 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 | 0-ACE Chain B from PDB Type:PROTEIN Length:147 aligned with HBB_LEIXA | P56251 from UniProtKB/Swiss-Prot Length:147 Alignment length:147 10 20 30 40 50 60 70 80 90 100 110 120 130 140 HBB_LEIXA 1 VDWTDAERAAIKALWGKIDVGEIGPQALSRLLIVYPWTQRHFKGFGNISTNAAILGNAKVAEHGKTVMGGLDRAVQNMDNIKNVYKQLSIKHSEKIHVDPDNFRLLGEIITMCVGAKFGPSAFTPEIHEAWQKFLAVVVSALGRQYH 147 SCOP domains d1spgb_ B: Hemoglobin, beta-chain SCOP domains CATH domains 1spgB00 B:1-147 Globins CATH domains Pfam domains ------Globin-1spgB01 B:7-111 ------------------------------------ Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ---GLOBIN PDB: B:4-147 UniProt: 4-147 PROSITE (2) Transcript --------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1spg B 1 VDWTDAERAAIKALWGKIDVGEIGPQALSRLLIVYPWTQRHFKGFGNISTNAAILGNAKVAEHGKTVMGGLDRAVQNMDNIKNVYKQLSIKHSEKIHVDPDNFRLLGEIITMCVGAKFGPSAFTPEIHEAWQKFLAVVVSALGRQYH 147 10 20 30 40 50 60 70 80 90 100 110 120 130 140
|
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A (HBA_LEIXA | P56250)
Chain B (HBB_LEIXA | P56251)
|
|
|
|
|
|
|