1SNZ - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF APO HUMAN GALACTOSE MUTAROTASE

Authors :   J. B. Thoden, D. J. Timson, R. J. Reece, H. M. Holden

Date :   12 Mar 04 (Deposition) - 30 Mar 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Mutarotase, Epimerase, Galactosemia, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. B. Thoden, D. J. Timson, R. J. Reece, H. M. Holden
Molecular Structure Of Human Galactose Mutarotase
J. Biol. Chem. V. 279 23431 2004
PubMed-ID: 15026423 | Reference-DOI: 10.1074/JBC.M402347200
(for further references see the PDB file header)

Molecule 1 - ALDOSE 1-EPIMERASE
	Chains	:	A, B
	EC Number	:	5.1.3.3
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PTYB12
	Expression System Strain	:	HMS174(DE3)
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GALM
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	GALACTOSE MUTAROTASE

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1SNZ)

(no "Site" information available for 1SNZ)

(no "SS Bond" information available for 1SNZ)

Asymmetric Unit

No.	Residues
1	Gly A:77	-	Arg A:78
2	Glu A:102	-	Pro A:103
3	Gly B:77	-	Arg B:78
4	Glu B:102	-	Pro B:103

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024451	N	190	Y	GALM_HUMAN	Polymorphism	6741892	A/B	N	190	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024451	N	190	Y	GALM_HUMAN	Polymorphism	6741892	A	N	190	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_024451	N	190	Y	GALM_HUMAN	Polymorphism	6741892	B	N	190	Y

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOSE_1_EPIMERASE	PS00545	Aldose 1-epimerase putative active site.	GALM_HUMAN	172-181	2	A:172-181 B:172-181

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOSE_1_EPIMERASE	PS00545	Aldose 1-epimerase putative active site.	GALM_HUMAN	172-181	1	A:172-181 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ALDOSE_1_EPIMERASE	PS00545	Aldose 1-epimerase putative active site.	GALM_HUMAN	172-181	1	- B:172-181

Asymmetric Unit (7, 14)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1a	ENST00000272252	1a	ENSE00001144695	chr2:38893052-38893493	442	GALM_HUMAN	1-64	64	2	A:1-64 B:1-64	64 64
1.2	ENST00000272252	2	ENSE00000962504	chr2:38903054-38903208	155	GALM_HUMAN	64-115	52	2	A:64-115 B:64-115	52 52
1.4b	ENST00000272252	4b	ENSE00000962505	chr2:38908422-38908628	207	GALM_HUMAN	116-184	69	2	A:116-184 B:116-184	69 69
1.5	ENST00000272252	5	ENSE00001072353	chr2:38916955-38917036	82	GALM_HUMAN	185-212	28	2	A:185-212 B:185-212	28 28
1.7	ENST00000272252	7	ENSE00001603788	chr2:38956698-38956839	142	GALM_HUMAN	212-259	48	2	A:212-259 B:212-259	48 48
1.8b	ENST00000272252	8b	ENSE00001272212	chr2:38958877-38959051	175	GALM_HUMAN	259-317	59	2	A:259-317 B:259-317	59 59
1.9b	ENST00000272252	9b	ENSE00001361889	chr2:38960630-38961910	1281	GALM_HUMAN	318-342	25	2	A:318-342 B:318-342	25 25

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:344
 aligned with GALM_HUMAN | Q96C23 from UniProtKB/Swiss-Prot  Length:342

    Alignment length:344
                              1                                                                                                                                                                                                                                                                                                                                                     
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338    
           GALM_HUMAN     - --MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA 342
               SCOP domains d1snza_ A: Galactose mutarotase                                                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 1snzA00 A:-1-342  [code=2.70.98.10, no name defined]                                                                                                                                                                                                                                                                                                     CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeeeeee....eeeeeeeee....eeeee....eeeeeeee.....eee......hhhhhhh.......ee.....ee...eeee..eeee........ee.....hhhhh..eeeee..eeeeeeee..hhhhh...eeeeeeeeee..eeeeeeeeee...ee...ee.................eeee.eeee.............ee...........eehhhhhhhh.....eeeeee......eeeeeee.....eeeeeee...eeeee.....eeeee.hhh.eee.....eeeee...hhhhh......ee.....eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y-------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALDOSE_1_E----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) --Exon 1.1a  PDB: A:1-64 UniProt: 1-64                            ---------------------------------------------------Exon 1.4b  PDB: A:116-184 UniProt: 116-184                           Exon 1.5  PDB: A:185-212    ----------------------------------------------Exon 1.8b  PDB: A:259-317 UniProt: 259-317                 Exon 1.9b  PDB: A:318-342 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------------------------Exon 1.2  PDB: A:64-115 UniProt: 64-115             ------------------------------------------------------------------------------------------------Exon 1.7  PDB: A:212-259 UniProt: 212-259       ----------------------------------------------------------------------------------- Transcript 1 (2)
                 1snz A  -1 GHMASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA 342
                                     8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338

Chain B from PDB  Type:PROTEIN  Length:342
 aligned with GALM_HUMAN | Q96C23 from UniProtKB/Swiss-Prot  Length:342

    Alignment length:342
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340  
           GALM_HUMAN     1 MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA 342
               SCOP domains d1snzb_ B: Galactose mutarotase                                                                                                                                                                                                                                                                                                                        SCOP domains
               CATH domains 1snzB00 B:1-342  [code=2.70.98.10, no name defined]                                                                                                                                                                                                                                                                                                    CATH domains
           Pfam domains (1) -------------------Aldose_epim-1snzB01 B:20-338                                                                                                                                                                                                                                                                                                   ---- Pfam domains (1)
           Pfam domains (2) -------------------Aldose_epim-1snzB02 B:20-338                                                                                                                                                                                                                                                                                                   ---- Pfam domains (2)
         Sec.struct. author ..eeeeeeeeee....eeeeeeeee....eeeee....eeeeeeee.....eee......hhhhhhh.......ee.....ee...eeee..eeee........ee.....hhhhh..eeeee..eeeeeeee..hhhhh...eeeeeeeee...eeeeeeeeee...ee...ee..ee.............eeee.eeee.............ee...........eehhhhhhhh.....eeeeee......eeeeeeee....eeeeeee...eeeee.....eeeee.hhh.eee....eeeeee...hhhhh......ee.....eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------Y-------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------ALDOSE_1_E----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1a  PDB: B:1-64 UniProt: 1-64                            ---------------------------------------------------Exon 1.4b  PDB: B:116-184 UniProt: 116-184                           Exon 1.5  PDB: B:185-212    ----------------------------------------------Exon 1.8b  PDB: B:259-317 UniProt: 259-317                 Exon 1.9b  PDB: B:318-342 Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------Exon 1.2  PDB: B:64-115 UniProt: 64-115             ------------------------------------------------------------------------------------------------Exon 1.7  PDB: B:212-259 UniProt: 212-259       ----------------------------------------------------------------------------------- Transcript 1 (2)
                 1snz B   1 MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA 342
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: Supersandwich (271)

Superfamily: Galactose mutarotase-like (205)

Family: Aldose 1-epimerase (mutarotase) (23)

Protein domain: Galactose mutarotase (22)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d1snza_	A:
1b	d1snzb_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Distorted Sandwich (506)

Topology: Beta-galactosidase; Chain A, domain 5 (250)

Homologous Superfamily: [code=2.70.98.10, no name defined] (116)

Human (Homo sapiens) (2)

1a	1snzB00	B:1-342
1b	1snzA00	A:-1-342

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Gal_mutarotase (81)

Family: Aldose_epim (24)

Homo sapiens (Human) (2)

1a	Aldose_epim-1snzB01	B:20-338
1b	Aldose_epim-1snzB02	B:20-338

Asymmetric Unit(hide GO term definitions)

Chain A,B (GALM_HUMAN | Q96C23)

molecular function
	GO:0004034	aldose 1-epimerase activity	Catalysis of the reaction: alpha-D-glucose = beta-D-glucose. Also acts on L-arabinose, D-xylose, D-galactose, maltose and lactose.
	GO:0030246	carbohydrate binding	Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0016853	isomerase activity	Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
biological process
	GO:0005975	carbohydrate metabolic process	The chemical reactions and pathways involving carbohydrates, any of a group of organic compounds based of the general formula Cx(H2O)y. Includes the formation of carbohydrate derivatives by the addition of a carbohydrate residue to another molecule.
	GO:0006012	galactose metabolic process	The chemical reactions and pathways involving galactose, the aldohexose galacto-hexose. D-galactose is widely distributed in combined form in plants, animals and microorganisms as a constituent of oligo- and polysaccharides; it also occurs in galactolipids and as its glucoside in lactose and melibiose.
	GO:0006006	glucose metabolic process	The chemical reactions and pathways involving glucose, the aldohexose gluco-hexose. D-glucose is dextrorotatory and is sometimes known as dextrose; it is an important source of energy for living organisms and is found free as well as combined in homo- and hetero-oligosaccharides and polysaccharides.
	GO:0019318	hexose metabolic process	The chemical reactions and pathways involving a hexose, any monosaccharide with a chain of six carbon atoms in the molecule.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1snz)

	Sites
(no "Sites" information available for 1snz)

	Cis Peptide Bonds
		Glu A:102 - Pro A:103	[ RasMol ]
		Glu B:102 - Pro B:103	[ RasMol ]
		Gly A:77 - Arg A:78	[ RasMol ]
		Gly B:77 - Arg B:78	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1snz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GALM_HUMAN \| Q96C23
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	5.1.3.3
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GALM_HUMAN \| Q96C23
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	GALM_HUMAN \| Q96C23	:	1so0

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (7, 14)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File