1SKZ - JenaLib

Asym.Unit - manually

Asymmetric Unit

Asym. Unit - sites

Biological Unit 1

Biol. Unit 1 - sites

collapse

expand

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Description

Title :   PROTEASE INHIBITOR

Authors :   U. Krengel, B. W. Dijkstra

Date :   16 Apr 97 (Deposition) - 22 Oct 97 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)

Keywords :   Antistasin, Crystal Structure, Factor Xa Inhibitor, Serine Protease Inhibitor, Thrombosis (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. Lapatto, U. Krengel, H. A. Schreuder, A. Arkema, B. De Boer, K. H. Kalk, W. G. Hol, P. D. Grootenhuis, J. W. Mulders, R. Dijkema, H. J. Theunissen, B. W. Dijkstra
X-Ray Structure Of Antistasin At 1. 9 A Resolution And Its Modelled Complex With Blood Coagulation Factor Xa.
Embo J. V. 16 5151 1997
PubMed-ID: 9311976 | Reference-DOI: 10.1093/EMBOJ/16.17.5151
(for further references see the PDB file header)

Compounds

Molecule 1 - ANTISTASIN
	Chains	:	A
	Engineered	:	YES
	Expression System	:	CRICETULUS GRISEUS
	Expression System Common	:	CHINESE HAMSTER
	Expression System Taxid	:	10029
	Expression System Vector	:	PKCRE
	Mutation	:	YES
	Organ	:	BLOOD
	Organism Common	:	MEXICAN LEECH
	Organism Scientific	:	HAEMENTERIA OFFICINALIS
	Organism Taxid	:	6410
	Synonym	:	FACTOR XA INHIBITOR

Structural Features

Chains, Units

		1
Asymmetric Unit	:	A
Biological Unit 1 (2x)	:	A

Summary Information (see also Sequences/Alignments below)

Ligands, Modified Residues, Ions (1, 1)

Asymmetric Unit (1, 1)

No.	Name	Count	Type	Full Name
1	CL	1	Ligand/Ion	CHLORIDE ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	CL	-1	Ligand/Ion	CHLORIDE ION

Sites (1, 1)

Asymmetric Unit (1, 1)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ARG A:45 , LYS A:52 , CYS A:53 , LYS A:100	BINDING SITE FOR RESIDUE CL A 201

SS Bonds (10, 10)

Asymmetric Unit

No.	Residues
1	A:8	-	A:19
2	A:13	-	A:26
3	A:28	-	A:48
4	A:33	-	A:51
5	A:37	-	A:53
6	A:62	-	A:73
7	A:67	-	A:80
8	A:82	-	A:103
9	A:88	-	A:106
10	A:92	-	A:108

Cis Peptide Bonds (0, 0)

(no "Cis Peptide Bond" information available for 1SKZ)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

Asymmetric Unit (3, 3)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ANTA_HAEOF_002 *	G	47	E	ANTA_HAEOF	---	---	A	G	30	E
2	UniProt	VAR_ANTA_HAEOF_003 *	M	52	V	ANTA_HAEOF	---	---	A	V	35	V
3	UniProt	VAR_ANTA_HAEOF_004 *	R	71	I	ANTA_HAEOF	---	---	A	R	54	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_ANTA_HAEOF_002 *	G	47	E	ANTA_HAEOF	---	---	A	G	30	E
2	UniProt	VAR_ANTA_HAEOF_003 *	M	52	V	ANTA_HAEOF	---	---	A	V	35	V
3	UniProt	VAR_ANTA_HAEOF_004 *	R	71	I	ANTA_HAEOF	---	---	A	R	54	I
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANTISTASIN	PS51252	Antistasin-like domain profile.	ANTA_HAEOF	45-70 100-125	2	A:28-53 A:83-108

Biological Unit 1 (1, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	ANTISTASIN	PS51252	Antistasin-like domain profile.	ANTA_HAEOF	45-70 100-125	4	A:28-53 A:83-108

Exons (0, 0)

(no "Exon" information available for 1SKZ)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:104
 aligned with ANTA_HAEOF | P15358 from UniProtKB/Swiss-Prot  Length:136

    Alignment length:104
                                    33        43        53        63        73        83        93       103       113       123    
           ANTA_HAEOF    24 GCEEAGCPEGSACNIITDRCTCSGVRCRMHCPHGFQRSRYGCEFCKCRLEPMKATCDISECPEGMMCSRLTNKCDCKIDINCRKTCPNGLKRDKLGCEYCECRP 127
               SCOP domains d1skza1 A:7-58 Factor Xa inhibitor antistasin       d1skza2 A:59-110 Factor Xa inhibitor antistasin      SCOP domains
               CATH domains 1skzA01 A:7-57 Antistasin; domain 1                1skzA02 A:58-110 Antistasin; domain 1                 CATH domains
               Pfam domains ---------------------Antistasin-1skzA01 A:28-53--------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhh.............................eee.....eeeee.................ee.........ee............eee.....eeeee.. Sec.struct. author
                 SAPs(SNPs) -----------------------E----V------------------I-------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------ANTISTASIN  PDB: A:28-53  -----------------------------ANTISTASIN  PDB: A:83-108 -- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------- Transcript
                 1skz A   7 GCEEAGCPEGSACNIITDRCTCSGVRCRVHCPHGFQRSRYGCEFCKCRLEPMKATCDISECPEGMMCSRLTNKCDCKIDINCRKTCPNGLKRDKLGCEYCECRP 110
                                    16        26        36        46        56        66        76        86        96       106

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Small proteins (3458)

Fold: Knottins (small inhibitors, toxins, lectins) (761)

Superfamily: Leech antihemostatic proteins (21)

Family: Huristasin-like (7)

Protein domain: Factor Xa inhibitor antistasin (1)

Mexican leech (Haementeria officinalis) [TaxId: 6410] (1)

1a	d1skza1	A:7-58
1b	d1skza2	A:59-110

CATH Domains (1, 2)

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Beta (13760)

Architecture: Ribbon (789)

Topology: Antistasin; domain 1 (8)

Homologous Superfamily: Antistasin; domain 1 (8)

Mexican leech (Haementeria officinalis) (1)

1a	1skzA01	A:7-57
1b	1skzA02	A:58-110

Pfam Domains (1, 1)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Antistasin] (1)

Family: Antistasin (1)

Haementeria officinalis (Mexican leech) (1)

Antistasin-1skzA01

A:28-53

Gene Ontology (10, 10)

Asymmetric Unit(hide GO term definitions)

Chain A (ANTA_HAEOF | P15358)

molecular function
	GO:0004857	enzyme inhibitor activity	Binds to and stops, prevents or reduces the activity of an enzyme.
	GO:0008201	heparin binding	Interacting selectively and non-covalently with heparin, any member of a group of glycosaminoglycans found mainly as an intracellular component of mast cells and which consist predominantly of alternating alpha-(1->4)-linked D-galactose and N-acetyl-D-glucosamine-6-sulfate residues.
	GO:0030414	peptidase inhibitor activity	Stops, prevents or reduces the activity of a peptidase, any enzyme that catalyzes the hydrolysis peptide bonds.
	GO:0004867	serine-type endopeptidase inhibitor activity	Stops, prevents or reduces the activity of serine-type endopeptidases, enzymes that catalyze the hydrolysis of nonterminal peptide bonds in a polypeptide chain; a serine residue (and a histidine residue) are at the active center of the enzyme.
biological process
	GO:0007596	blood coagulation	The sequential process in which the multiple coagulation factors of the blood interact, ultimately resulting in the formation of an insoluble fibrin clot; it may be divided into three stages: stage 1, the formation of intrinsic and extrinsic prothrombin converting principle; stage 2, the formation of thrombin; stage 3, the formation of stable fibrin polymers.
	GO:0007599	hemostasis	The stopping of bleeding (loss of body fluid) or the arrest of the circulation to an organ or part.
	GO:0050819	negative regulation of coagulation	Any process that stops, prevents, or reduces the frequency, rate or extent of coagulation.
	GO:0010951	negative regulation of endopeptidase activity	Any process that decreases the frequency, rate or extent of endopeptidase activity, the endohydrolysis of peptide bonds within proteins.
	GO:0010466	negative regulation of peptidase activity	Any process that stops or reduces the rate of peptidase activity, the hydrolysis of peptide bonds within proteins.
cellular component
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		CL	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1skz)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Still Images

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1skz
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	ANTA_HAEOF \| P15358
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Analysis Tools

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	ANTA_HAEOF \| P15358
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 1)

Sites (1, 1)

SS Bonds (10, 10)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 3)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 1)

Gene Ontology (10, 10)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File