Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTALLOGRAPHIC SNAPSHOTS OF ASPERGILLUS FUMIGATUS PHYTASE REVEALING ITS ENZYMATIC DYNAMICS
 
Authors :  Q. Liu, Q. Huang, X. G. Lei, Q. Hao
Date :  04 Mar 04  (Deposition) - 28 Sep 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.69
Chains :  Asym./Biol. Unit :  A
Keywords :  Small Alpha Domain, Big Alpha/Beta Domain, Catalytic Sites, Water Structures, Catalytic Dynamics, Product Release Pathway, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Q. Liu, Q. Huang, X. G. Lei, Q. Hao
Crystallographic Snapshots Of Aspergillus Fumigatus Phytase Revealing Its Enzymatic Dynamics
Structure V. 12 1575 2004
PubMed-ID: 15341723  |  Reference-DOI: 10.1016/J.STR.2004.06.015

(-) Compounds

Molecule 1 - 3-PHYTASE A
    Chains: A
    EC Number: 3.1.3.8
    Engineered: YES
    Expression System: PICHIA PASTORIS
    Expression System Taxid: 4922
    Gene: PHYA
    Organism Scientific: ASPERGILLUS FUMIGATUS
    Organism Taxid: 5085
    Synonym: MYO-INOSITOL-HEXAPHOSPHATE 3- PHOSPHOHYDROLASE A, 3 PHYTASE A, MYO-INOSITOL HEXAKISPHOSPHATE PHOSPHOHYDROLASE A

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric/Biological Unit (1, 4)
No.NameCountTypeFull Name
1NAG4Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (4, 4)

Asymmetric Unit (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASN A:184 , THR A:313 , THR A:315 , ASN A:316 , SER A:317 , TRP A:439 , HOH A:709 , HOH A:798 , HOH A:983BINDING SITE FOR RESIDUE NAG A 503
2AC2SOFTWARETHR A:182 , PHE A:183 , ASN A:184 , ASN A:316 , HOH A:628 , HOH A:725 , HOH A:936 , HOH A:999BINDING SITE FOR RESIDUE NAG A 504
3AC3SOFTWARELEU A:349 , ASN A:353 , HIS A:411 , GLY A:412 , GLY A:429 , TRP A:432 , HOH A:545 , HOH A:560 , HOH A:690 , HOH A:708 , HOH A:961BINDING SITE FOR RESIDUE NAG A 505
4AC4SOFTWARELEU A:200 , GLU A:203 , ASN A:207 , ARG A:360 , ASP A:416 , ARG A:420 , HOH A:596 , HOH A:623 , HOH A:625 , HOH A:806 , HOH A:920BINDING SITE FOR RESIDUE NAG A 506

(-) SS Bonds  (5, 5)

Asymmetric/Biological Unit
No.Residues
1A:8 -A:17
2A:48 -A:391
3A:192 -A:442
4A:241 -A:259
5A:413 -A:421

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1SKA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SKA)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1HIS_ACID_PHOSPHAT_1PS00616 Histidine acid phosphatases phosphohistidine signature.PHYA_ASPFU72-86  1A:50-64
2HIS_ACID_PHOSPHAT_2PS00778 Histidine acid phosphatases active site signature.PHYA_ASPFU353-369  1A:332-348

(-) Exons   (0, 0)

(no "Exon" information available for 1SKA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:435
 aligned with PHYA_ASPFU | O00092 from UniProtKB/Swiss-Prot  Length:465

    Alignment length:435
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459     
           PHYA_ASPFU    30 CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF 464
               SCOP domains d1skaa_ A: Phytase (myo-inositol-hexakisphosphate-3-phosphohydrolase)                                                                                                                                                                                                                                                                                                                                                                               SCOP domains
               CATH domains --------------------------------------------1skaA01 A:52-442 Phosphoglycerate mutase-like                                                                                                                                                                                                                                                                                                                                                         - CATH domains
               Pfam domains -----------------------------------------His_Phos_2-1skaA01 A:49-404                                                                                                                                                                                                                                                                                                                                        --------------------------------------- Pfam domains
         Sec.struct. author .ee...ee..hhhhhh.hhhhh..................eeeeeeeeee.......hhhhhhhhhhhhhhhhhhh...hhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhh....eeeee.hhhhhhhhhhhhhhhhhhhhh...........eeeee..............hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.........hhhhhh..........eeeee.hhhhhhhhhhhh.......................hhhhhh....eeeeeeeee......eeeeee..ee.............eehhhhhhhhhhhhhh.hhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------HIS_ACID_PHOSPH--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HIS_ACID_PHOSPHAT----------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ska A   8 CDTVDLGYQCSPATSHLWGQYSPFFSLEDELSVSSKLPKDCRITLVQVLSRHGARYPTSSKSKKYKKLVTAIQANATDFKGKFAFLKTYNYTLGADDLTPFGEQQLVNSGIKFYQRYKALARSVVPFIRASGSDRVIASGEKFIEGFQQAKLADPGATNRAAPAISVIIPESETFNNTLDHGVCTKFEASQLGDEVAANFTALFAPDIRARAEKHLPGVTLTDEDVVSLMDMCSFDTVARTSDASQLSPFCQLFTHNEWKKYNYLQSLGKYYGYGAGNPLGPAQGIGFTNELIARLTRSPVQDHTSTNSTLVSNPATFPLNATMYVDFSHDNSMVSIFFALGLYNGTEPLSRTSVESAKELDGYSASWVVPFGARAYFETMQCKSEKEPLVRALINDRVVPLHGCDVDKLGRCKLNDFVKGLSWARSGGNWGECF 443
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       168       178       188       198       208       218       228       238       248       258       268       278       288       298       308       318       328       338       348       358       368       378       388       398       408       418       428       438     
                                                                                                                                                                                       165|                                                                                                                                                                                                                                                                                    
                                                                                                                                                                                        167                                                                                                                                                                                                                                                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: PGM (50)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (PHYA_ASPFU | O00092)
molecular function
    GO:0016158    3-phytase activity    Catalysis of the reaction: myo-inositol hexakisphosphate + H2O = D-myo-inositol 1,2,4,5,6-pentakisphosphate + phosphate.
    GO:0003993    acid phosphatase activity    Catalysis of the reaction: an orthophosphoric monoester + H2O = an alcohol + phosphate, with an acid pH optimum.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016791    phosphatase activity    Catalysis of the hydrolysis of phosphoric monoesters, releasing inorganic phosphate.
biological process
    GO:0016311    dephosphorylation    The process of removing one or more phosphoric (ester or anhydride) residues from a molecule.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ska)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ska
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  PHYA_ASPFU | O00092
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  3.1.3.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  PHYA_ASPFU | O00092
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        PHYA_ASPFU | O00092: 1qwo 1sk8 1sk9 1skb

(-) Related Entries Specified in the PDB File

1qwo 1sk8 1sk9 1skb