|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 7)| Asymmetric/Biological Unit (2, 7) |
Sites (7, 7)
Asymmetric Unit (7, 7)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1SK2) |
Cis Peptide Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1SK2) |
PROSITE Motifs (1, 1)
Asymmetric/Biological Unit (1, 1)
|
||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1SK2) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:138 aligned with ARSC1_ECOLX | P08692 from UniProtKB/Swiss-Prot Length:141 Alignment length:138 12 22 32 42 52 62 72 82 92 102 112 122 132 ARSC1_ECOLX 3 NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLRKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL 140 SCOP domains d1sk2a_ A: automated matches SCOP domains CATH domains 1sk2A00 A:3-140 Glutaredoxin CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ARSC PDB: A:3-133 UniProt: 3-133 ------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1sk2 A 3 NITIYHNPACGTSRNTLEMIRNSGTEPTIILYLENPPSRDELVKLIADMGISVRALLAKNVEPYEQLGLAEDKFTDDQLIDFMLQHPILINRPIVVTPLGTRLCRPSEVVLDILQDAQKGAFTKEDGEKVVDEAGKRL 140 12 22 32 42 52 62 72 82 92 102 112 122 132
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric/Biological Unit
|
CATH Domains (1, 1)
Asymmetric/Biological Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1SK2) |
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A (ARSC1_ECOLX | P08692)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|