Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  COMPARING SKELETAL AND CARDIAC CALSEQUESTRIN STRUCTURES AND THEIR CALCIUM BINDING: A PROPOSED MECHANISM FOR COUPLED CALCIUM BINDING AND PROTEIN POLYMERIZATION
 
Authors :  H. J. Park, I. Y. Park, E. J. Kim, B. Youn, K. Fields, A. K. Dunker, C. H. Kang
Date :  03 Mar 04  (Deposition) - 15 Mar 05  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Calsequestrin, Glycoprotein, Calcium-Binding, Muscle Protein, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. J. Park, I. Y. Park, E. J. Kim, B. Youn, K. Fields, A. K. Dunker, C. H. Kang
Comparing Skeletal And Cardiac Calsequestrin Structures And Their Calcium Binding: A Proposed Mechanism For Coupled Calcium Binding And Protein Polymerization.
J. Biol. Chem. V. 279 18026 2004
PubMed-ID: 14871888  |  Reference-DOI: 10.1074/JBC.M311553200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - CALSEQUESTRIN, CARDIAC MUSCLE ISOFORM
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PTYB1
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: CASQ2
    Organism Common: DOG
    Organism Scientific: CANIS LUPUS FAMILIARIS
    Organism Taxid: 9615
    Strain: FAMILIARIS
    Synonym: CALSEQUESTRIN 2

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SJI)

(-) Sites  (0, 0)

(no "Site" information available for 1SJI)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1SJI)

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Gln A:171 -Pro A:172
2Lys A:211 -Pro A:212
3Gln B:171 -Pro B:172
4Lys B:211 -Pro B:212

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SJI)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CALSEQUESTRIN_2PS00864 Calsequestrin signature 2.CASQ2_CANLF357-376
 		  2A:338-352
B:338-352

(-) Exons   (0, 0)

(no "Exon" information available for 1SJI)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:350
 aligned with CASQ2_CANLF | P12637 from UniProtKB/Swiss-Prot  Length:410

    Alignment length:350
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371
          CASQ2_CANLF    22 GLNFPTYDGKDRVVSLTEKNFKQVLKKYDVLCLYYHESVSSDKVAQKQFQLKEIVLELVAQVLEHKDIGFVMVDAKKEAKLAKKLGFDEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIINSKLEVQAFERIEDQIKLIGFFKSEESEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPDKPYTEEELVEFVKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAERSDPDGYEFLEILKQVARDNTDNPDLSIVWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKIN 371
               SCOP domains d1sjia1 A:3-126 automated matches                                                                                           d1sjia2 A:127-228 automated matches                                                                   d1sjia3 A:229-352 automated matches                                                                                          SCOP domains
               CATH domains 1sjiA01 A:3-126 Glutaredoxin                                                                                                1sjiA02 A:127-228 Glutaredoxin                                                                        1sjiA03 A:229-352 Glutaredoxin                                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............eeehhhhhhhhhh...eeeeeee.........hhhhhhhhhhhhhhhhhhhhh.eeeeeee...hhhhhhhhh.....eeeeee..eeeee....hhhhhhhhhhh.....eee..hhhhhhhhhhh....eeeee.....hhhhhhhhhhhhhh....eeeee.hhhhhhhhh.....eeee.......ee......hhhhhhhhhhhhh...eee....hhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhhhhh....eeeehhhhhhhhhhhhhhhh.......eeeeee.....eee..........hhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CALSEQUESTRIN_2 PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sji A   3 GLNFPTYDGKDRVVSLTEKNFKQVLKKYDVLCLYYHESVSSDKVAQKQFQLKEIVLELVAQVLEHKDIGFVMVDAKKEAKLAKKLGFDEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIINSKLEVQAFERIEDQIKLIGFFKSEESEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPDKPYTEEELVEFVKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAERSDPDGYEFLEILKQVARDNTDNPDLSIVWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKIN 352
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352


Chain B from PDB  Type:PROTEIN  Length:350
 aligned with CASQ2_CANLF | P12637 from UniProtKB/Swiss-Prot  Length:410

    Alignment length:350
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371
          CASQ2_CANLF    22 GLNFPTYDGKDRVVSLTEKNFKQVLKKYDVLCLYYHESVSSDKVAQKQFQLKEIVLELVAQVLEHKDIGFVMVDAKKEAKLAKKLGFDEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIINSKLEVQAFERIEDQIKLIGFFKSEESEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPDKPYTEEELVEFVKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAERSDPDGYEFLEILKQVARDNTDNPDLSIVWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKIN 371
               SCOP domains d1sjib1 B:3-126 automated matches                                                                                           d1sjib2 B:127-228 automated matches                                                                   d1sjib3 B:229-352 automated matches                                                                                          SCOP domains
               CATH domains 1sjiB01 B:3-126 Glutaredoxin                                                                                                1sjiB02 B:127-228 Glutaredoxin                                                                        1sjiB03 B:229-352 Glutaredoxin                                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .............ee....hhhhhhh...eeeeeee.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeee....hhhhhh........eeee....ee......hhhhhhhhhhhhh...eeee.hhhhhhhhhhh....eeeee.....hhhhhhhhhhhhh.....eeeee.hhhhhhhh......eeee.......ee......hhhhhhhhhhhh....eee....hhhhhhhh....eeeeee....hhhhhhhhhhhhhhhhhh.......eeeehhhhhhhhhhhhhhhhh......eeeeee.....eeee.........hhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CALSEQUESTRIN_2 PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1sji B   3 GLNFPTYDGKDRVVSLTEKNFKQVLKKYDVLCLYYHESVSSDKVAQKQFQLKEIVLELVAQVLEHKDIGFVMVDAKKEAKLAKKLGFDEEGSLYVLKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIINSKLEVQAFERIEDQIKLIGFFKSEESEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPDKPYTEEELVEFVKEHQRPTLRRLRPEDMFETWEDDLNGIHIVAFAERSDPDGYEFLEILKQVARDNTDNPDLSIVWIDPDDFPLLVAYWEKTFKIDLFKPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKIN 352
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 6)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1SJI)

(-) Gene Ontology  (8, 8)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (CASQ2_CANLF | P12637)
molecular function
    GO:0005509    calcium ion binding    Interacting selectively and non-covalently with calcium ions (Ca2+).
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0060315    negative regulation of ryanodine-sensitive calcium-release channel activity    Any process that decreases the activity of a ryanodine-sensitive calcium-release channel. The ryanodine-sensitive calcium-release channel catalyzes the transmembrane transfer of a calcium ion by a channel that opens when a ryanodine class ligand has been bound by the channel complex or one of its constituent parts.
    GO:0010880    regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum    Any process that modulates the rate, frequency or extent of release of sequestered calcium ion into cytosol by the sarcoplasmic reticulum, the process in which the release of sequestered calcium ion by sarcoplasmic reticulum into cytosol occurs via calcium release channels.
cellular component
    GO:0016529    sarcoplasmic reticulum    A fine reticular network of membrane-limited elements that pervades the sarcoplasm of a muscle cell; continuous over large portions of the cell and with the nuclear envelope; that part of the endoplasmic reticulum specialized for calcium release, uptake and storage.
    GO:0033018    sarcoplasmic reticulum lumen    The volume enclosed by the membranes of the sarcoplasmic reticulum.
    GO:0005891    voltage-gated calcium channel complex    A protein complex that forms a transmembrane channel through which calcium ions may pass in response to changes in membrane potential.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sji)
 
  Sites
(no "Sites" information available for 1sji)
 
  Cis Peptide Bonds
    Gln A:171 - Pro A:172   [ RasMol ]  
    Gln B:171 - Pro B:172   [ RasMol ]  
    Lys A:211 - Pro A:212   [ RasMol ]  
    Lys B:211 - Pro B:212   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sji
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CASQ2_CANLF | P12637
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  CASQ2_CANLF | P12637
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SJI)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SJI)