Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ACIDIC SEMINAL FLUID PROTEIN (ASFP) AT 1.9 A RESOLUTION: A BOVINE POLYPEPTIDE FROM THE SPERMADHESIN FAMILY
 
Authors :  M. J. Romao, I. Kolln, J. M. Dias, A. L. Carvalho, A. Romero, P. F. Varela, L. Sanz, E. Topfer-Petersen, J. J. Calvete
Date :  24 Jun 97  (Deposition) - 24 Jun 98  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (2x)
Keywords :  Spermadhesin, Bovine Seminal Plasma Protein, Acidic Seminal Fluid Protein, Asfp, Cub Domain, X-Ray Crystal Structure, Growth Factor (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Romero, M. J. Romao, P. F. Varela, I. Kolln, J. M. Dias, A. L. Carvalho, L. Sanz, E. Topfer-Petersen, J. J. Calvete
The Crystal Structures Of Two Spermadhesins Reveal The Cub Domain Fold.
Nat. Struct. Biol. V. 4 783 1997
PubMed-ID: 9334740  |  Reference-DOI: 10.1038/NSB1097-783
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ASFP
    Chains: A
    Organism Common: CATTLE
    Organism Scientific: BOS TAURUS
    Organism Taxid: 9913
    Other Details: ASFP
    Secretion: SEMINAL PLASMA
    Synonym: ACIDIC SEMINAL PROTEIN

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (2x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1SFP)

(-) Sites  (0, 0)

(no "Site" information available for 1SFP)

(-) SS Bonds  (2, 2)

Asymmetric Unit
No.Residues
1A:10 -A:31
2A:54 -A:75

(-) Cis Peptide Bonds  (1, 1)

Asymmetric Unit
No.Residues
1Asp A:111 -Pro A:112

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1SFP)

(-) PROSITE Motifs  (3, 3)

Asymmetric Unit (3, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CUBPS01180 CUB domain profile.SPAD1_BOVIN30-131  1A:10-111
2SPERMADHESIN_1PS00985 Spermadhesins family signature 1.SPAD1_BOVIN30-54  1A:10-34
3SPERMADHESIN_2PS00986 Spermadhesins family signature 2.SPAD1_BOVIN74-95  1A:54-75
Biological Unit 1 (3, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1CUBPS01180 CUB domain profile.SPAD1_BOVIN30-131  2A:10-111
2SPERMADHESIN_1PS00985 Spermadhesins family signature 1.SPAD1_BOVIN30-54  2A:10-34
3SPERMADHESIN_2PS00986 Spermadhesins family signature 2.SPAD1_BOVIN74-95  2A:54-75

(-) Exons   (0, 0)

(no "Exon" information available for 1SFP)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:111
 aligned with SPAD1_BOVIN | P29392 from UniProtKB/Swiss-Prot  Length:134

    Alignment length:111
                                    33        43        53        63        73        83        93       103       113       123       133 
          SPAD1_BOVIN    24 LPRNTNCGGILKEESGVIATYYGPKTNCVWTIQMPPEYHVRVSIQYLQLNCNKESLEIIDGLPGSPVLGKICEGSLMDYRSSGSIMTVKYIREPEHPASFYEVLYFQDPQA 134
               SCOP domains d1sfpa_ A: Acidic seminal fluid protein (ASFP)                                                                  SCOP domains
               CATH domains 1sfpA00 A:4-114  [code=2.60.120.290, no name defined]                                                           CATH domains
               Pfam domains ------CUB-1sfpA01 A:10-108                                                                               ------ Pfam domains
         Sec.struct. author ........eee...eeeee.......eeeeeee.....eeeeee.eee.....eeeeee.......eeeee.eee.eeee....eeeeeeee.........eeeeeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) ------CUB  PDB: A:10-111 UniProt: 30-131                                                                    --- PROSITE (1)
                PROSITE (2) ------SPERMADHESIN_1           -------------------SPERMADHESIN_2        --------------------------------------- PROSITE (2)
                 Transcript --------------------------------------------------------------------------------------------------------------- Transcript
                 1sfp A   4 LPRNTNCGGILKEESGVIATYYGPKTNCVWTIQMPPEYHVRVSIQYLQLNCNKESLEIIDGLPGSPVLGKICEGSLMDYRSSGSIMTVKYIREPEHPASFYEVLYFQDPQA 114
                                    13        23        33        43        53        63        73        83        93       103       113
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric Unit
(-)
Class: All beta proteins (24004)

(-) CATH Domains  (1, 1)

Asymmetric Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: CUB (11)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A   (SPAD1_BOVIN | P29392)
molecular function
    GO:0008083    growth factor activity    The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
biological process
    GO:0007338    single fertilization    The union of male and female gametes to form a zygote.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1sfp)
 
  Sites
(no "Sites" information available for 1sfp)
 
  Cis Peptide Bonds
    Asp A:111 - Pro A:112   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1sfp
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  SPAD1_BOVIN | P29392
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  SPAD1_BOVIN | P29392
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1SFP)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1SFP)