1SCF - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Biological Unit 3 (Jmol Viewer)

Title :   HUMAN RECOMBINANT STEM CELL FACTOR

Authors :   X. Jiang, O. Gurel, K. E. Langley, W. A. Hendrickson

Date :   04 Jun 98 (Deposition) - 07 Jul 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)
Biol. Unit 3: A (1x),B (1x),C (1x),D (1x)

Keywords :   Human Stem Cell Factor, Steel Factor, Kit Ligand, Mast Cell Growth Factor, Hormone/Growth Factor Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. Jiang, O. Gurel, E. A. Mendiaz, G. W. Stearns, C. L. Clogston, H. S. Lu, T. D. Osslund, R. S. Syed, K. E. Langley, W. A. Hendrickson
Structure Of The Active Core Of Human Stem Cell Factor And Analysis Of Binding To Its Receptor Kit.
Embo J. V. 19 3192 2000
PubMed-ID: 10880433 | Reference-DOI: 10.1093/EMBOJ/19.13.3192
(for further references see the PDB file header)

Molecule 1 - STEM CELL FACTOR
	Chains	:	A, B, C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	SCF, SL, MGF, MAST CELL GROWTH FACTOR

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D
Biological Unit 3 (1x)	:	A (1x)	B (1x)	C (1x)	D (1x)

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (3, 16)

No.	Name	Count	Type	Full Name
1	1PE	1	Ligand/Ion	PENTAETHYLENE GLYCOL
2	CA	3	Ligand/Ion	CALCIUM ION
3	MSE	12	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 1 (2, 7)

No.	Name	Count	Type	Full Name
1	1PE	1	Ligand/Ion	PENTAETHYLENE GLYCOL
2	CA	-1	Ligand/Ion	CALCIUM ION
3	MSE	6	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 2 (1, 6)

No.	Name	Count	Type	Full Name
1	1PE	-1	Ligand/Ion	PENTAETHYLENE GLYCOL
2	CA	-1	Ligand/Ion	CALCIUM ION
3	MSE	6	Mod. Amino Acid	SELENOMETHIONINE

Biological Unit 3 (1, 6)

No.	Name	Count	Type	Full Name
1	1PE	-1	Ligand/Ion	PENTAETHYLENE GLYCOL
2	CA	-1	Ligand/Ion	CALCIUM ION
3	MSE	6	Mod. Amino Acid	SELENOMETHIONINE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP A:137 , VAL A:139 , HOH A:1507 , GLU D:113 , HOH D:1024 , HOH D:1025	BINDING SITE FOR RESIDUE CA D 1021
2	AC2	SOFTWARE	ASP B:85 , GLU B:88 , ASP D:54 , ASP D:58 , HOH D:1026 , HOH D:1157	BINDING SITE FOR RESIDUE CA D 1022
3	AC3	SOFTWARE	PHE B:102 , HOH B:1161 , ASN C:81 , HOH C:1027 , HOH C:1028 , HOH C:1029	BINDING SITE FOR RESIDUE CA C 1023
4	AC4	SOFTWARE	SER A:141 , ARG B:108 , ARG B:117 , TYR D:32 , ARG D:108 , PHE D:110 , GLU D:114	BINDING SITE FOR RESIDUE 1PE B 249

Asymmetric Unit

No.	Residues
1	A:43	-	A:138
2	B:43	-	B:138

Asymmetric Unit

No.	Residues
1	Ser A:104	-	Pro A:105

Asymmetric Unit (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_063237	N	36	S	SCF_HUMAN	Disease (FPHH)	121918653	A/B/C/D	N	11	S
2	UniProt	VAR_042652	T	54	A	SCF_HUMAN	Polymorphism	3741457	A/B/C/D	T	29	A
3	UniProt	VAR_076223	L	104	V	SCF_HUMAN	Unclassified	864309655	A/B/C/D	L	79	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_063237	N	36	S	SCF_HUMAN	Disease (FPHH)	121918653	A/B	N	11	S
2	UniProt	VAR_042652	T	54	A	SCF_HUMAN	Polymorphism	3741457	A/B	T	29	A
3	UniProt	VAR_076223	L	104	V	SCF_HUMAN	Unclassified	864309655	A/B	L	79	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (3, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_063237	N	36	S	SCF_HUMAN	Disease (FPHH)	121918653	C/D	N	11	S
2	UniProt	VAR_042652	T	54	A	SCF_HUMAN	Polymorphism	3741457	C/D	T	29	A
3	UniProt	VAR_076223	L	104	V	SCF_HUMAN	Unclassified	864309655	C/D	L	79	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (3, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_063237	N	36	S	SCF_HUMAN	Disease (FPHH)	121918653	A/B/C/D	N	11	S
2	UniProt	VAR_042652	T	54	A	SCF_HUMAN	Polymorphism	3741457	A/B/C/D	T	29	A
3	UniProt	VAR_076223	L	104	V	SCF_HUMAN	Unclassified	864309655	A/B/C/D	L	79	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1SCF)

Asymmetric Unit (4, 16)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000228280	1	ENSE00000993383	chr12:88974238-88974041	198	SCF_HUMAN	1-5	5	0	-	-
1.3	ENST00000228280	3	ENSE00000909415	chr12:88939642-88939529	114	SCF_HUMAN	6-43	38	4	A:11-18 B:11-18 C:11-18 D:11-18	8 8 8 8
1.5	ENST00000228280	5	ENSE00000909413	chr12:88926280-88926218	63	SCF_HUMAN	44-64	21	4	A:19-39 B:19-39 C:19-39 D:19-39	21 21 21 21
1.6	ENST00000228280	6	ENSE00000537922	chr12:88912644-88912474	171	SCF_HUMAN	65-121	57	4	A:40-91 B:40-96 C:40-91 D:40-90	52 57 52 51
1.7	ENST00000228280	7	ENSE00000752892	chr12:88910267-88910111	157	SCF_HUMAN	122-174	53	4	A:104-141 B:97-138 (gaps) C:104-126 D:104-127	38 42 23 24
1.8	ENST00000228280	8	ENSE00001416325	chr12:88909394-88909311	84	SCF_HUMAN	174-202	29	0	-	-
1.9	ENST00000228280	9	ENSE00000843426	chr12:88900914-88900805	110	SCF_HUMAN	202-238	37	0	-	-
1.10	ENST00000228280	10	ENSE00000843425	chr12:88900155-88900088	68	SCF_HUMAN	239-261	23	0	-	-
1.11	ENST00000228280	11	ENSE00001303130	chr12:88899012-88898936	77	SCF_HUMAN	261-273	13	0	-	-
1.12	ENST00000228280	12	ENSE00000993382	chr12:88890958-88886566	4393	SCF_HUMAN	-	0	0	-	-

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:119
 aligned with SCF_HUMAN | P21583 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:131
                                    45        55        65        75        85        95       105       115       125       135       145       155       165 
            SCF_HUMAN    36 NVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVS 166
               SCOP domains d1scfa_ A: Stem cell factor, SCF                                                                                                    SCOP domains
               CATH domains 1scfA00 A:11-141  [code=1.20.1250.10, no name defined]                                                                              CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.......eee.........hhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh..------------...eee..hhhhhhhhhhhhhhhh.............. Sec.struct. author
                 SAPs(SNPs) S-----------------A-------------------------------------------------V-------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3Exon 1.5  PDB: A:19-3Exon 1.6  PDB: A:40-91 UniProt: 65-121 [INCOMPLETE]      Exon 1.7  PDB: A:104-141 UniProt: 122-174     Transcript 1
                 1scf A  11 NVKDVTKLVANLPKDYmITLKYVPGmDVLPSHCWISEmVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVK------------SPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVS 141
                                    20      | 30     |  40       |50        60        70        80        90|        -   |   110       120       130       140 
                                           27-MSE   36-MSE      48-MSE                                     91          104

Chain B from PDB  Type:PROTEIN  Length:121
 aligned with SCF_HUMAN | P21583 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:128
                                    45        55        65        75        85        95       105       115       125       135       145       155        
            SCF_HUMAN    36 NVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDC 163
               SCOP domains d1scfb_ B: Stem cell factor, SCF                                                                                                 SCOP domains
               CATH domains 1scfB00 B:11-138  [code=1.20.1250.10, no name defined]                                                                           CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.......eee.........hhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhh..............eee..hhhhhhhhhhhhhhhh..-------.. Sec.struct. author
                 SAPs(SNPs) S-----------------A-------------------------------------------------V----------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3Exon 1.5  PDB: B:19-3Exon 1.6  PDB: B:40-96 UniProt: 65-121                   Exon 1.7  PDB: B:97-138 (gaps)             Transcript 1
                 1scf B  11 NVKDVTKLVANLPKDYmITLKYVPGmDVLPSHCWISEmVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDF-------DC 138
                                    20      | 30     |  40       |50        60        70        80        90       100       110       120        |-      | 
                                           27-MSE   36-MSE      48-MSE                                                                          129     137

Chain C from PDB  Type:PROTEIN  Length:104
 aligned with SCF_HUMAN | P21583 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:116
                                    45        55        65        75        85        95       105       115       125       135       145      
            SCF_HUMAN    36 NVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAF 151
               SCOP domains d1scfc_ C: Stem cell factor, SCF                                                                                     SCOP domains
               CATH domains 1scfC00 C:11-126  [code=1.20.1250.10, no name defined]                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhh.......eee.........hhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhh.------------...eee..hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) S-----------------A-------------------------------------------------V----------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3Exon 1.5  PDB: C:19-3Exon 1.6  PDB: C:40-91 UniProt: 65-121 [INCOMPLETE]      Exon 1.7  PDB: C:104-126       Transcript 1
                 1scf C  11 NVKDVTKLVANLPKDYmITLKYVPGmDVLPSHCWISEmVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVK------------SPEPRLFTPEEFFRIFNRSIDAF 126
                                    20      | 30     |  40       |50        60        70        80        90|        -   |   110       120      
                                           27-MSE   36-MSE      48-MSE                                     91          104

Chain D from PDB  Type:PROTEIN  Length:104
 aligned with SCF_HUMAN | P21583 from UniProtKB/Swiss-Prot  Length:273

    Alignment length:117
                                    45        55        65        75        85        95       105       115       125       135       145       
            SCF_HUMAN    36 NVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFK 152
               SCOP domains d1scfd_ D: Stem cell factor, SCF                                                                                      SCOP domains
               CATH domains 1scfD00 D:11-127  [code=1.20.1250.10, no name defined]                                                                CATH domains
           Pfam domains (1) SCF-1scfD01 D:11-127                                                                                                  Pfam domains (1)
           Pfam domains (2) SCF-1scfD02 D:11-127                                                                                                  Pfam domains (2)
           Pfam domains (3) SCF-1scfD03 D:11-127                                                                                                  Pfam domains (3)
           Pfam domains (4) SCF-1scfD04 D:11-127                                                                                                  Pfam domains (4)
         Sec.struct. author .hhhhhhhhhh.......eee.........hhh..hhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.-------------...eee..hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) S-----------------A-------------------------------------------------V------------------------------------------------ SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.3Exon 1.5  PDB: D:19-3Exon 1.6  PDB: D:40-90 UniProt: 65-121 [INCOMPLETE]      Exon 1.7  PDB: D:104-127        Transcript 1
                 1scf D  11 NVKDVTKLVANLPKDYmITLKYVPGmDVLPSHCWISEmVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECV-------------SPEPRLFTPEEFFRIFNRSIDAFK 127
                                    20      | 30     |  40       |50        60        70        80        90         -   |   110       120       
                                           27-MSE   36-MSE      48-MSE                                    90           104

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: 4-helical cytokines (168)

Superfamily: 4-helical cytokines (168)

Family: Short-chain cytokines (78)

Protein domain: Stem cell factor, SCF (3)

Human (Homo sapiens) [TaxId: 9606] (3)

1a	d1scfa_	A:
1b	d1scfb_	B:
1c	d1scfc_	C:
1d	d1scfd_	D:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Growth Hormone; Chain: A; (136)

Homologous Superfamily: [code=1.20.1250.10, no name defined] (130)

Human (Homo sapiens) (110)

1a	1scfB00	B:11-138
1b	1scfA00	A:11-141
1c	1scfC00	C:11-126
1d	1scfD00	D:11-127

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: 4H_Cytokine (48)

Family: SCF (3)

Homo sapiens (Human) (1)

1a	SCF-1scfD01	D:11-127
1b	SCF-1scfD02	D:11-127
1c	SCF-1scfD03	D:11-127
1d	SCF-1scfD04	D:11-127

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (SCF_HUMAN | P21583)

molecular function
	GO:0005088	Ras guanyl-nucleotide exchange factor activity	Stimulates the exchange of guanyl nucleotides associated with a GTPase of the Ras superfamily. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
	GO:0005125	cytokine activity	Functions to control the survival, growth, differentiation and effector function of tissues and cells.
	GO:0008083	growth factor activity	The function that stimulates a cell to grow or proliferate. Most growth factors have other actions besides the induction of cell growth or proliferation.
	GO:0046934	phosphatidylinositol-4,5-bisphosphate 3-kinase activity	Catalysis of the reaction: 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + ATP = a 1-phosphatidyl-1D-myo-inositol 3,4,5-trisphosphate + ADP + 2 H(+).
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005173	stem cell factor receptor binding	Interacting selectively and non-covalently with the stem cell factor receptor (SCFR), a type III transmembrane kinase receptor.
biological process
	GO:0000165	MAPK cascade	An intracellular protein kinase cascade containing at least a MAPK, a MAPKK and a MAP3K. The cascade can also contain two additional tiers: the upstream MAP4K and the downstream MAP Kinase-activated kinase (MAPKAPK). The kinases in each tier phosphorylate and activate the kinases in the downstream tier to transmit a signal within a cell.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0008283	cell proliferation	The multiplication or reproduction of cells, resulting in the expansion of a cell population.
	GO:0035234	ectopic germ cell programmed cell death	Programmed cell death of an errant germ line cell that is outside the normal migratory path or ectopic to the gonad. This is an important mechanism of regulating germ cell survival within the embryo.
	GO:0035162	embryonic hemopoiesis	The stages of blood cell formation that take place within the embryo.
	GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	A series of molecular signals in which a signal is conveyed from the cell surface to trigger the apoptotic death of a cell. The pathway starts with withdrawal of a ligand from a cell surface receptor, and ends when the execution phase of apoptosis is triggered.
	GO:0008584	male gonad development	The process whose specific outcome is the progression of the male gonad over time, from its formation to the mature structure.
	GO:0043066	negative regulation of apoptotic process	Any process that stops, prevents, or reduces the frequency, rate or extent of cell death by apoptotic process.
	GO:0033026	negative regulation of mast cell apoptotic process	Any process that stops, prevents, or reduces the frequency, rate, or extent of mast cell apoptotic process.
	GO:0001755	neural crest cell migration	The characteristic movement of cells from the dorsal ridge of the neural tube to a variety of locations in a vertebrate embryo.
	GO:0001541	ovarian follicle development	The process whose specific outcome is the progression of the ovarian follicle over time, from its formation to the mature structure.
	GO:0046854	phosphatidylinositol phosphorylation	The process of introducing one or more phosphate groups into a phosphatidylinositol, any glycerophosphoinositol having one phosphatidyl group esterified to one of the hydroxy groups of inositol.
	GO:0048015	phosphatidylinositol-mediated signaling	A series of molecular signals in which a cell uses a phosphatidylinositol-mediated signaling to convert a signal into a response. Phosphatidylinositols include phosphatidylinositol (PtdIns) and its phosphorylated derivatives.
	GO:0045740	positive regulation of DNA replication	Any process that activates or increases the frequency, rate or extent of DNA replication.
	GO:0043547	positive regulation of GTPase activity	Any process that activates or increases the activity of a GTPase.
	GO:0043406	positive regulation of MAP kinase activity	Any process that activates or increases the frequency, rate or extent of MAP kinase activity.
	GO:0046579	positive regulation of Ras protein signal transduction	Any process that activates or increases the frequency, rate or extent of Ras protein signal transduction.
	GO:0008284	positive regulation of cell proliferation	Any process that activates or increases the rate or extent of cell proliferation.
	GO:1902035	positive regulation of hematopoietic stem cell proliferation	Any process that activates or increases the frequency, rate or extent of hematopoietic stem cell proliferation.
	GO:0002687	positive regulation of leukocyte migration	Any process that activates or increases the frequency, rate, or extent of leukocyte migration.
	GO:0070668	positive regulation of mast cell proliferation	Any process that activates or increases the rate or extent of mast cell proliferation.
	GO:0045636	positive regulation of melanocyte differentiation	Any process that activates or increases the frequency, rate or extent of melanocyte differentiation.
	GO:0002763	positive regulation of myeloid leukocyte differentiation	Any process that activates or increases the frequency, rate, or extent of myeloid leukocyte differentiation.
	GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	Any process that activates or increases the frequency, rate or extent of the phosphorylation of peptidyl-tyrosine.
	GO:0014066	regulation of phosphatidylinositol 3-kinase signaling	Any process that modulates the frequency, rate or extent of signal transduction mediated by the phosphatidylinositol 3-kinase cascade.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0005615	extracellular space	That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		1PE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		CA	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MSE	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Ser A:104 - Pro A:105	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format \| Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1scf
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	SCF_HUMAN \| P21583
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	145250
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	SCF_HUMAN \| P21583
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	SCF_HUMAN \| P21583	:	1exz 2e9w

(no "Related Entries Specified in the PDB File" available for 1SCF)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (3, 16)

Sites (4, 4)

SS Bonds (2, 2)

Cis Peptide Bonds (1, 1)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 12)

PROSITE Motifs (0, 0)

Exons (4, 16)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (1, 4)

Pfam Domains (1, 4)

Gene Ontology (39, 39)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File