|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| NMR Structure (2, 2) |
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (3, 3)
NMR Structure
|
||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1S8K) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1S8K) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1S8K) |
Exons (0, 0)| (no "Exon" information available for 1S8K) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:31 aligned with KA171_MESMA | Q95NJ8 from UniProtKB/Swiss-Prot Length:55 Alignment length:31 33 43 53 KA171_MESMA 24 QTQCQSVRDCQQYCLTPDRCSYGTCYCKTTG 54 SCOP domains ------------------------------- SCOP domains CATH domains ------------------------------- CATH domains Pfam domains -Toxin_2-1s8kA01 A:2-28 --- Pfam domains SAPs(SNPs) ------------------------------- SAPs(SNPs) PROSITE ------------------------------- PROSITE Transcript ------------------------------- Transcript 1s8k A 1 xTQCQSVRDCQQYCLTPDRCSYGTCYCKTTx 31 | 10 20 30| | 31-NH2 1-PCA
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 1S8K) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1S8K) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (KA171_MESMA | Q95NJ8)
|
||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|