Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  STRUCTURE IN SOLUTION OF A METHIONINE-RICH 2S ALBUMIN PROTEIN FROM SUNFLOWER SEED
 
Authors :  D. Pantoja-Uceda, M. Bruix, P. R. Shewry, J. Santoro, M. Rico
Date :  23 Jan 04  (Deposition) - 29 Jun 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  All Helix, Folded Leaf, Right-Handed Superhelix, Disulphide Rich, Plant Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Pantoja-Uceda, P. R. Shewry, M. Bruix, A. S. Tatham, J. Santoro, M. Rico
Solution Structure Of A Methionine-Rich 2S Albumin From Sunflower Seeds: Relationship To Its Allergenic And Emulsifying Properties.
Biochemistry V. 43 6976 2004
PubMed-ID: 15170335  |  Reference-DOI: 10.1021/BI0496900
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ALBUMIN 8
    Chains: A
    Organism Common: COMMON SUNFLOWER
    Organism Scientific: HELIANTHUS ANNUUS
    Organism Taxid: 4232
    Synonym: METHIONINE-RICH 2S PROTEIN, SFA8

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1S6D)

(-) Sites  (0, 0)

(no "Site" information available for 1S6D)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:11 -A:62
2A:24 -A:51
3A:52 -A:94
4A:64 -A:101

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S6D)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S6D)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1S6D)

(-) Exons   (0, 0)

(no "Exon" information available for 1S6D)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:103
 aligned with 2SS8_HELAN | P23110 from UniProtKB/Swiss-Prot  Length:141

    Alignment length:103
                                    48        58        68        78        88        98       108       118       128       138   
           2SS8_HELAN    39 PYGRGRTESGCYQQMEEAEMLNHCGMYLMKNLGERSQVSPRMREEDHKQLCCMQLKNLDEKCMCPAIMMMLNEPMWIRMRDQVMSMAHNLPIECNLMSQPCQM 141
               SCOP domains d1s6da_ A: Methionine-rich 2S protein (albumin 8)                                                       SCOP domains
               CATH domains ---------1s6dA01 A:10-94 Bifunctional Trypsin/Alpha-Amylase Inhibitor                         --------- CATH domains
               Pfam domains --------Tryp_alpha_amyl-1s6dA01 A:9-102                                                               - Pfam domains
         Sec.struct. author .........hhhhhhhhh...hhhhhhhh..................hhhhhhhhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhh......... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------- Transcript
                 1s6d A   1 PYGRGRTESGCYQQMEEAEMLNHCGMYLMKNLGERSQVSPRMREEDHKQLCCMQLKNLDEKCMCPAIMMMLNEPMWIRMRDQVMSMAHNLPIECNLMSQPCQM 103
                                    10        20        30        40        50        60        70        80        90       100
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Prolamin (17)

(-) Gene Ontology  (1, 1)

NMR Structure(hide GO term definitions)
Chain A   (2SS8_HELAN | P23110)
molecular function
    GO:0045735    nutrient reservoir activity    Functions in the storage of nutritious substrates.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1s6d)
 
  Sites
(no "Sites" information available for 1s6d)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s6d)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s6d
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  2SS8_HELAN | P23110
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  2SS8_HELAN | P23110
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1S6D)

(-) Related Entries Specified in the PDB File

6082 CHEMICAL SHIFTS