Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AVRPPHF ORF2, A TYPE III EFFECTOR FROM P. SYRINGAE
 
Authors :  A. U. Singer, D. Desveaux, L. Betts, J. H. Chang, Z. Nimchuk, S. R. Grant, J. K. Dangl, J. Sondek
Date :  07 Jan 04  (Deposition) - 14 Sep 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A
Keywords :  Predominantly Beta-Strand, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. U. Singer, D. Desveaux, L. Betts, J. H. Chang, Z. Nimchuk, S. R. Grant, J. K. Dangl, J. Sondek
Crystal Structures Of The Type Iii Effector Protein Avrpphf And Its Chaperone Reveal Residues Required For Plant Pathogenesis
Structure V. 12 1669 2004
PubMed-ID: 15341731  |  Reference-DOI: 10.1016/J.STR.2004.06.023
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ORF2
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PPROEX-HTA
    Expression System Strain: BL21 RIL CODON PLUS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: AVRPPHF ORF2
    Gene: AVRPPHF ORF2
    Mutation: YES
    Organism Scientific: PSEUDOMONAS SYRINGAE PV. PHASEOLICOLA
    Organism Taxid: 319

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1S21)

(-) Sites  (0, 0)

(no "Site" information available for 1S21)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1S21)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S21)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S21)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1S21)

(-) Exons   (0, 0)

(no "Exon" information available for 1S21)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:165
 aligned with Q9K2L5_PSESH | Q9K2L5 from UniProtKB/TrEMBL  Length:204

    Alignment length:176
                                    38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198      
         Q9K2L5_PSESH    29 PSRFVGQYTLTSIHQLSSEERENFLDAHDPMRVYDLNSETSVYRTTQREYVRNGYATGNPNSGAIIALHEELQESPYAQHIGARPDQADAYRPRTAHVSSLNTPSLNVMAGQGALSALRGYAGSDHVTTEMRLGDFLDQGGKVYSDTSAMSAGGDSVEALIVTLPKGRKVPVNILD 204
               SCOP domains d1s21a_ A: AvrPphF ORF2, a type III effector                                                                                                                                     SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -AvrPphF-ORF-2-1s21A01 A:30-203                                                                                                                                                - Pfam domains
         Sec.struct. author ...........hhhhhhhhhhhhhhhhhhhhhhh......eeeeeehhhhhh..eee.......eeeeeeeeee............hhh.eeeeeee.hhhh..eeeeee..hhhhhh-------.eeeeeehhhhhh....eee...----.....eeeeee.....eee.ee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s21 A  29 PSRFVGQYTLTSIHQLSSEERENFLDAHDPMRVYDLNSETSVYRTTQREYVRNGYATGNPNSGAIIALHEELQESPYAQHIGARPDQADAYRPRTAHVSSLNTPSLNVMAGQGALSAL-------HVTTEMRLGDFLDQGGKVYSDTS----GGDSVEALIVTLPKGRKVPVNILD 204
                                    38        48        58        68        78        88        98       108       118       128       138       | -     | 158       168       | -  |    188       198      
                                                                                                                                               146     154                   176  181
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1S21)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: AvrPphF-ORF-2] (1)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 1S21)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1s21)
 
  Sites
(no "Sites" information available for 1s21)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s21)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s21
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9K2L5_PSESH | Q9K2L5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9K2L5_PSESH | Q9K2L5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1S21)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S21)