Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  EIF2GAMMA APO
 
Authors :  A. Roll-Mecak, P. Alone, C. Cao, T. E. Dever, S. K. Burley
Date :  04 Jan 04  (Deposition) - 20 Jan 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym./Biol. Unit :  A
Keywords :  Translation Initiation, Gtpase, Ef-1A, Trna, Eif2 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Roll-Mecak, P. Alone, C. Cao, T. E. Dever, S. K. Burley
X-Ray Structure Of Translation Initiation Factor Eif2Gamma: Implications For Trna And Eif2Alpha Binding.
J. Biol. Chem. V. 279 10634 2004
PubMed-ID: 14688270  |  Reference-DOI: 10.1074/JBC.M310418200
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TRANSLATION INITIATION FACTOR 2 GAMMA SUBUNIT
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PGEX-6P-1
    Gene: EIF2G, MJ1261
    Organism Scientific: METHANOCALDOCOCCUS JANNASCHII
    Organism Taxid: 2190
    Synonym: EIF-2-GAMMA

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1ZN1Ligand/IonZINC ION

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:87 , CYS A:90 , CYS A:99 , CYS A:102BINDING SITE FOR RESIDUE ZN A 1

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:90 -A:102

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1S0U)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1S0U)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1S0U)

(-) Exons   (0, 0)

(no "Exon" information available for 1S0U)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:391
 aligned with IF2G_METJA | Q58657 from UniProtKB/Swiss-Prot  Length:411

    Alignment length:404
                                    17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407    
           IF2G_METJA     8 KQAEVNIGMVGHVDHGKTSLTKALTGVWTDRHSEELRRGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLRRVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGTIAENAPIIPISAHHEANIDVLLKAIQDFIPTPKRDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTEGNKTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRVVGTKEELKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIEG 411
               SCOP domains d1s0ua3 A:34-229 Initiation fa       ctor eIF2 gamma subunit, N-terminal (G) domain                                                                                                                 d1s0ua1 A:230-347 Initiation factor eIF2 gamma subunit, domain II                                                     d1s0ua2 A:348-437 Initiation factor eIF2 gamma subunit                                     SCOP domains
               CATH domains 1s0uA01 A:34-230 P-loop contai       ning nucleotide triphosphate hydrolases                                                                                                                         1s0uA02 A:231-345 Translation factors                                                                              1s0uA03 A:346-437 Translation factors                                                        CATH domains
               Pfam domains -GTP_EFTU-1s0uA01 A:35-227                                                                                                                                                                        ------------------------------GTP_EFTU_D2-1s0uA02 A:258-340                                                      --------eIF2_C-1s0uA03 A:349-435                                                               -- Pfam domains
         Sec.struct. author ....eeeeee.....hhhhhhhhhhh....-------.......eeeeeeeee......ee............eeeeeeeeee..hhhhhhhhhhh......eeeeeee......hhhhhhhhhhhhhh....eeeeee...........hhhhhhhhhhh........eee.------hhhhhhhhhhhhh...........eeeeeeee.......hhhhh...eeeeeeee..ee...eeeeeeeeee......eeeeeeee..eeee..eee.ee.....eeee...hhhhhhhhh....eee.......eeeeeeeeeee....................eeeeee..eeeeeeeeeee..eeeeeeeeeee.....eeeeeee....eeeeeeeeeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1s0u A  34 SQAEVNIGMVGHVDHGKTSLTKALTGVWTD-------RGISIRLGYADCEIRKCPQCGTYTTKPRCPNCLAETEFLRRVSFVDSPGHETLMATMLSGASLMDGAILVIAANEPCPQPQTKEHLMALEILGIDKIIIVQNKIDLVDEKQAEENYEQIKEFVKGTIAENAPIIPI------NIDVLLKAIQDFIPTPKRDPDATPRMYVARSFDINKPGTEIKDLKGGVLGGAIIQGVFKVGDEIEIRPGIKVTEGNKTFWKPLTTKIVSLAAGNTILRKAHPGGLIGVGTTLDPYLTKSDALTGSVVGLPGTLPPIREKITIRANLLDRVVGTKEELKIEPLRTGEVLMLNIGTATTAGVITSARGDIADIKLKLPICAEIGDRVAISRRVGSRWRLIGYGTIEG 437
                                    43        53        63       |73        83        93       103       113       123       133       143       153       163       173       183       193       203  |    213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423       433    
                                                        63      71                                                                                                                                    206    213
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Class: All beta proteins (24004)
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (2, 3)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (3, 3)

Asymmetric/Biological Unit
(-)
Clan: P-loop_NTPase (1112)
(-)
Clan: no clan defined [family: GTP_EFTU_D2] (39)
(-)
Clan: no clan defined [family: eIF2_C] (10)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (IF2G_METJA | Q58657)
molecular function
    GO:0005525    GTP binding    Interacting selectively and non-covalently with GTP, guanosine triphosphate.
    GO:0003924    GTPase activity    Catalysis of the reaction: GTP + H2O = GDP + phosphate.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0003746    translation elongation factor activity    Functions in chain elongation during polypeptide synthesis at the ribosome.
    GO:0003743    translation initiation factor activity    Functions in the initiation of ribosome-mediated translation of mRNA into a polypeptide.
biological process
    GO:0001731    formation of translation preinitiation complex    The joining of the small ribosomal subunit, ternary complex, and mRNA.
    GO:0006412    translation    The cellular metabolic process in which a protein is formed, using the sequence of a mature mRNA or circRNA molecule to specify the sequence of amino acids in a polypeptide chain. Translation is mediated by the ribosome, and begins with the formation of a ternary complex between aminoacylated initiator methionine tRNA, GTP, and initiation factor 2, which subsequently associates with the small subunit of the ribosome and an mRNA or circRNA. Translation ends with the release of a polypeptide chain from the ribosome.
    GO:0006414    translational elongation    The successive addition of amino acid residues to a nascent polypeptide chain during protein biosynthesis.
    GO:0006413    translational initiation    The process preceding formation of the peptide bond between the first two amino acids of a protein. This includes the formation of a complex of the ribosome, mRNA or circRNA, and an initiation complex that contains the first aminoacyl-tRNA.
cellular component
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1s0u)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1s0u
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IF2G_METJA | Q58657
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IF2G_METJA | Q58657
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1S0U)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1S0U)