|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 4)| Asymmetric Unit (3, 4) Biological Unit 1 (2, 9) |
Sites (4, 4)
Asymmetric Unit (4, 4)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1RNJ) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1RNJ) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1RNJ) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1RNJ) |
Exons (0, 0)| (no "Exon" information available for 1RNJ) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:140 aligned with DUT_ECOLI | P06968 from UniProtKB/Swiss-Prot Length:151 Alignment length:152 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149 DUT_ECOLI - -MKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDFDATDRGEGGFGHSGRQ 151 SCOP domains d1rnja_ A: Deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) SCOP domains CATH domains 1rnjA00 A:1-152 [code=2.70.40.10, no name defined] CATH domains Pfam domains ---------------dUTPase-1rnjA01 A:16-146 -- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 1rnj A 1 MMKKIDVKILDPRVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRSGLGHKHGIVLGNLVGLINSDYQGQLMISVWNRGQDSFTIQPGERIAQMIFVPVVQAEFNLVEDF----R----F----RQ 152 10 20 30 40 50 60 70 80 90 100 110 120 130 | -| | -| 136 141 146 151
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)| Asymmetric Unit |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (10, 10)|
Asymmetric Unit(hide GO term definitions) Chain A (DUT_ECOLI | P06968)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|