|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (5, 6)
Asymmetric Unit (5, 6)
|
Sites (6, 6)
Asymmetric Unit (6, 6)
|
SS Bonds (6, 6)
Asymmetric Unit
|
||||||||||||||||||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1RKI) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1RKI) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1RKI) |
Exons (0, 0)| (no "Exon" information available for 1RKI) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:101 aligned with Q8ZYK2_PYRAE | Q8ZYK2 from UniProtKB/TrEMBL Length:98 Alignment length:101 98 10 20 30 40 50 60 70 80 90 | - Q8ZYK2_PYRAE 1 MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVN--- - SCOP domains d1rkia1 A:1-98 Hypothetical protein PAE0736 --- SCOP domains CATH domains ----------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------- Transcript 1rki A 1 MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP 101 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:97 aligned with Q8ZYK2_PYRAE | Q8ZYK2 from UniProtKB/TrEMBL Length:98 Alignment length:97 10 20 30 40 50 60 70 80 90 Q8ZYK2_PYRAE 1 MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRV 97 SCOP domains d1rkib_ B: Hypothetical protein PAE0736 SCOP domains CATH domains ------------------------------------------------------------------------------------------------- CATH domains Pfam domains (1) ---DUF3195-1rkiB01 B:4-92 ----- Pfam domains (1) Pfam domains (2) ---DUF3195-1rkiB02 B:4-92 ----- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------- Transcript 1rki B 1 MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRV 97 10 20 30 40 50 60 70 80 90
|
||||||||||||||||||||
SCOP Domains (1, 2)| Asymmetric Unit |
CATH Domains (0, 0)| (no "CATH Domain" information available for 1RKI) |
Pfam Domains (1, 2)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 1RKI)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|