1RJ7 - JenaLib

Asymmetric Unit (51, 612)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_005187	H	252	L	EDA_HUMAN	Disease (XHED)	879255552	A/B/D/E/F/G/H/I/J/K/L/M	H	252	L
02	UniProt	VAR_013485	H	252	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	H	252	Y
03	UniProt	VAR_011077	G	255	C	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	255	C
04	UniProt	VAR_011078	G	255	D	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	255	D
05	UniProt	VAR_071454	A	259	E	EDA_HUMAN	Disease (STHAGX1)	879255611	A/B/D/E/F/G/H/I/J/K/L/M	A	259	E
06	UniProt	VAR_071455	I	260	S	EDA_HUMAN	Disease (STHAGX1)	---	A/B/D/E/F/G/H/I/J/K/L/M	I	260	S
07	UniProt	VAR_064862	L	266	R	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	L	266	R
08	UniProt	VAR_013486	G	269	V	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	269	V
09	UniProt	VAR_011079	W	274	G	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	W	274	G
10	UniProt	VAR_064863	W	274	R	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	W	274	R
11	UniProt	VAR_071456	R	289	C	EDA_HUMAN	Disease (STHAGX1)	879255551	A/B/D/E/F/G/H/I/J/K/L/M	R	289	C
12	UniProt	VAR_071457	R	289	L	EDA_HUMAN	Disease (STHAGX1)	---	A/B/D/E/F/G/H/I/J/K/L/M	R	289	L
13	UniProt	VAR_010613	G	291	R	EDA_HUMAN	Disease (XHED)	397516677	A/B/D/E/F/G/H/I/J/K/L/M	G	291	R
14	UniProt	VAR_010614	G	291	W	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	291	W
15	UniProt	VAR_064864	L	293	P	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	L	293	P
16	UniProt	VAR_064865	L	296	V	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	L	296	V
17	UniProt	VAR_010615	D	298	H	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	D	298	H
18	UniProt	VAR_054466	D	298	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	D	298	Y
19	UniProt	VAR_064866	G	299	D	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	299	D
20	UniProt	VAR_005188	G	299	S	EDA_HUMAN	Disease (XHED)	397516679	A/B/D/E/F/G/H/I/J/K/L/M	G	299	S
21	UniProt	VAR_013487	F	302	S	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	F	302	S
22	UniProt	VAR_075316	Y	304	H	EDA_HUMAN	Unclassified (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	Y	304	H
23	UniProt	VAR_054467	Q	306	H	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	Q	306	H
24	UniProt	VAR_054468	V	307	G	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	V	307	G
25	UniProt	VAR_075317	D	316	E	EDA_HUMAN	Unclassified (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	D	316	E
26	UniProt	VAR_067319	S	319	R	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	S	319	R
27	UniProt	VAR_054469	Y	320	C	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	Y	320	C
28	UniProt	VAR_064867	V	323	G	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	V	323	G
29	UniProt	VAR_075318	C	332	F	EDA_HUMAN	Unclassified (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	C	332	F
30	UniProt	VAR_011080	C	332	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	C	332	Y
31	UniProt	VAR_071458	R	334	H	EDA_HUMAN	Disease (STHAGX1)	142948132	A/B/D/E/F/G/H/I/J/K/L/M	R	334	H
32	UniProt	VAR_064868	T	338	M	EDA_HUMAN	Disease (STHAGX1)	132630321	A/B/D/E/F/G/H/I/J/K/L/M	T	338	M
33	UniProt	VAR_054470	Y	343	C	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	Y	343	C
34	UniProt	VAR_064869	C	346	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	C	346	Y
35	UniProt	VAR_005189	A	349	T	EDA_HUMAN	Disease (XHED)	132630317	A/B/D/E/F/G/H/I/J/K/L/M	A	349	T
36	UniProt	VAR_075319	G	350	D	EDA_HUMAN	Unclassified (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	350	D
37	UniProt	VAR_067250	L	354	P	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	L	354	P
38	UniProt	VAR_005190	A	356	D	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	A	356	D
39	UniProt	VAR_064870	A	356	V	EDA_HUMAN	Disease (XHED)	876657639	A/B/D/E/F/G/H/I/J/K/L/M	A	356	V
40	UniProt	VAR_005191	R	357	P	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	R	357	P
41	UniProt	VAR_054471	Q	358	E	EDA_HUMAN	Disease (XHED)	132630320	A/B/D/E/F/G/H/I/J/K/L/M	Q	358	E
42	UniProt	VAR_075320	Q	358	H	EDA_HUMAN	Unclassified (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	Q	358	H
43	UniProt	VAR_054472	I	360	N	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	I	360	N
44	UniProt	VAR_054473	N	372	D	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	N	372	D
45	UniProt	VAR_054474	M	373	I	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	M	373	I
46	UniProt	VAR_054475	S	374	R	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	S	374	R
47	UniProt	VAR_013488	T	378	M	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	T	378	M
48	UniProt	VAR_054476	T	378	P	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	T	378	P
49	UniProt	VAR_071459	F	379	V	EDA_HUMAN	Disease (STHAGX1)	---	A/B/D/E/F/G/H/I/J/K/L/M	F	379	V
50	UniProt	VAR_064871	G	381	R	EDA_HUMAN	Disease (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	381	R
51	UniProt	VAR_075321	G	381	V	EDA_HUMAN	Unclassified (XHED)	---	A/B/D/E/F/G/H/I/J/K/L/M	G	381	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (51, 153)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_005187	H	252	L	EDA_HUMAN	Disease (XHED)	879255552	A/B/D	H	252	L
02	UniProt	VAR_013485	H	252	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D	H	252	Y
03	UniProt	VAR_011077	G	255	C	EDA_HUMAN	Disease (XHED)	---	A/B/D	G	255	C
04	UniProt	VAR_011078	G	255	D	EDA_HUMAN	Disease (XHED)	---	A/B/D	G	255	D
05	UniProt	VAR_071454	A	259	E	EDA_HUMAN	Disease (STHAGX1)	879255611	A/B/D	A	259	E
06	UniProt	VAR_071455	I	260	S	EDA_HUMAN	Disease (STHAGX1)	---	A/B/D	I	260	S
07	UniProt	VAR_064862	L	266	R	EDA_HUMAN	Disease (XHED)	---	A/B/D	L	266	R
08	UniProt	VAR_013486	G	269	V	EDA_HUMAN	Disease (XHED)	---	A/B/D	G	269	V
09	UniProt	VAR_011079	W	274	G	EDA_HUMAN	Disease (XHED)	---	A/B/D	W	274	G
10	UniProt	VAR_064863	W	274	R	EDA_HUMAN	Disease (XHED)	---	A/B/D	W	274	R
11	UniProt	VAR_071456	R	289	C	EDA_HUMAN	Disease (STHAGX1)	879255551	A/B/D	R	289	C
12	UniProt	VAR_071457	R	289	L	EDA_HUMAN	Disease (STHAGX1)	---	A/B/D	R	289	L
13	UniProt	VAR_010613	G	291	R	EDA_HUMAN	Disease (XHED)	397516677	A/B/D	G	291	R
14	UniProt	VAR_010614	G	291	W	EDA_HUMAN	Disease (XHED)	---	A/B/D	G	291	W
15	UniProt	VAR_064864	L	293	P	EDA_HUMAN	Disease (XHED)	---	A/B/D	L	293	P
16	UniProt	VAR_064865	L	296	V	EDA_HUMAN	Disease (XHED)	---	A/B/D	L	296	V
17	UniProt	VAR_010615	D	298	H	EDA_HUMAN	Disease (XHED)	---	A/B/D	D	298	H
18	UniProt	VAR_054466	D	298	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D	D	298	Y
19	UniProt	VAR_064866	G	299	D	EDA_HUMAN	Disease (XHED)	---	A/B/D	G	299	D
20	UniProt	VAR_005188	G	299	S	EDA_HUMAN	Disease (XHED)	397516679	A/B/D	G	299	S
21	UniProt	VAR_013487	F	302	S	EDA_HUMAN	Disease (XHED)	---	A/B/D	F	302	S
22	UniProt	VAR_075316	Y	304	H	EDA_HUMAN	Unclassified (XHED)	---	A/B/D	Y	304	H
23	UniProt	VAR_054467	Q	306	H	EDA_HUMAN	Disease (XHED)	---	A/B/D	Q	306	H
24	UniProt	VAR_054468	V	307	G	EDA_HUMAN	Disease (XHED)	---	A/B/D	V	307	G
25	UniProt	VAR_075317	D	316	E	EDA_HUMAN	Unclassified (XHED)	---	A/B/D	D	316	E
26	UniProt	VAR_067319	S	319	R	EDA_HUMAN	Disease (XHED)	---	A/B/D	S	319	R
27	UniProt	VAR_054469	Y	320	C	EDA_HUMAN	Disease (XHED)	---	A/B/D	Y	320	C
28	UniProt	VAR_064867	V	323	G	EDA_HUMAN	Disease (XHED)	---	A/B/D	V	323	G
29	UniProt	VAR_075318	C	332	F	EDA_HUMAN	Unclassified (XHED)	---	A/B/D	C	332	F
30	UniProt	VAR_011080	C	332	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D	C	332	Y
31	UniProt	VAR_071458	R	334	H	EDA_HUMAN	Disease (STHAGX1)	142948132	A/B/D	R	334	H
32	UniProt	VAR_064868	T	338	M	EDA_HUMAN	Disease (STHAGX1)	132630321	A/B/D	T	338	M
33	UniProt	VAR_054470	Y	343	C	EDA_HUMAN	Disease (XHED)	---	A/B/D	Y	343	C
34	UniProt	VAR_064869	C	346	Y	EDA_HUMAN	Disease (XHED)	---	A/B/D	C	346	Y
35	UniProt	VAR_005189	A	349	T	EDA_HUMAN	Disease (XHED)	132630317	A/B/D	A	349	T
36	UniProt	VAR_075319	G	350	D	EDA_HUMAN	Unclassified (XHED)	---	A/B/D	G	350	D
37	UniProt	VAR_067250	L	354	P	EDA_HUMAN	Disease (XHED)	---	A/B/D	L	354	P
38	UniProt	VAR_005190	A	356	D	EDA_HUMAN	Disease (XHED)	---	A/B/D	A	356	D
39	UniProt	VAR_064870	A	356	V	EDA_HUMAN	Disease (XHED)	876657639	A/B/D	A	356	V
40	UniProt	VAR_005191	R	357	P	EDA_HUMAN	Disease (XHED)	---	A/B/D	R	357	P
41	UniProt	VAR_054471	Q	358	E	EDA_HUMAN	Disease (XHED)	132630320	A/B/D	Q	358	E
42	UniProt	VAR_075320	Q	358	H	EDA_HUMAN	Unclassified (XHED)	---	A/B/D	Q	358	H
43	UniProt	VAR_054472	I	360	N	EDA_HUMAN	Disease (XHED)	---	A/B/D	I	360	N
44	UniProt	VAR_054473	N	372	D	EDA_HUMAN	Disease (XHED)	---	A/B/D	N	372	D
45	UniProt	VAR_054474	M	373	I	EDA_HUMAN	Disease (XHED)	---	A/B/D	M	373	I
46	UniProt	VAR_054475	S	374	R	EDA_HUMAN	Disease (XHED)	---	A/B/D	S	374	R
47	UniProt	VAR_013488	T	378	M	EDA_HUMAN	Disease (XHED)	---	A/B/D	T	378	M
48	UniProt	VAR_054476	T	378	P	EDA_HUMAN	Disease (XHED)	---	A/B/D	T	378	P
49	UniProt	VAR_071459	F	379	V	EDA_HUMAN	Disease (STHAGX1)	---	A/B/D	F	379	V
50	UniProt	VAR_064871	G	381	R	EDA_HUMAN	Disease (XHED)	---	A/B/D	G	381	R
51	UniProt	VAR_075321	G	381	V	EDA_HUMAN	Unclassified (XHED)	---	A/B/D	G	381	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (51, 153)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_005187	H	252	L	EDA_HUMAN	Disease (XHED)	879255552	E/F/G	H	252	L
02	UniProt	VAR_013485	H	252	Y	EDA_HUMAN	Disease (XHED)	---	E/F/G	H	252	Y
03	UniProt	VAR_011077	G	255	C	EDA_HUMAN	Disease (XHED)	---	E/F/G	G	255	C
04	UniProt	VAR_011078	G	255	D	EDA_HUMAN	Disease (XHED)	---	E/F/G	G	255	D
05	UniProt	VAR_071454	A	259	E	EDA_HUMAN	Disease (STHAGX1)	879255611	E/F/G	A	259	E
06	UniProt	VAR_071455	I	260	S	EDA_HUMAN	Disease (STHAGX1)	---	E/F/G	I	260	S
07	UniProt	VAR_064862	L	266	R	EDA_HUMAN	Disease (XHED)	---	E/F/G	L	266	R
08	UniProt	VAR_013486	G	269	V	EDA_HUMAN	Disease (XHED)	---	E/F/G	G	269	V
09	UniProt	VAR_011079	W	274	G	EDA_HUMAN	Disease (XHED)	---	E/F/G	W	274	G
10	UniProt	VAR_064863	W	274	R	EDA_HUMAN	Disease (XHED)	---	E/F/G	W	274	R
11	UniProt	VAR_071456	R	289	C	EDA_HUMAN	Disease (STHAGX1)	879255551	E/F/G	R	289	C
12	UniProt	VAR_071457	R	289	L	EDA_HUMAN	Disease (STHAGX1)	---	E/F/G	R	289	L
13	UniProt	VAR_010613	G	291	R	EDA_HUMAN	Disease (XHED)	397516677	E/F/G	G	291	R
14	UniProt	VAR_010614	G	291	W	EDA_HUMAN	Disease (XHED)	---	E/F/G	G	291	W
15	UniProt	VAR_064864	L	293	P	EDA_HUMAN	Disease (XHED)	---	E/F/G	L	293	P
16	UniProt	VAR_064865	L	296	V	EDA_HUMAN	Disease (XHED)	---	E/F/G	L	296	V
17	UniProt	VAR_010615	D	298	H	EDA_HUMAN	Disease (XHED)	---	E/F/G	D	298	H
18	UniProt	VAR_054466	D	298	Y	EDA_HUMAN	Disease (XHED)	---	E/F/G	D	298	Y
19	UniProt	VAR_064866	G	299	D	EDA_HUMAN	Disease (XHED)	---	E/F/G	G	299	D
20	UniProt	VAR_005188	G	299	S	EDA_HUMAN	Disease (XHED)	397516679	E/F/G	G	299	S
21	UniProt	VAR_013487	F	302	S	EDA_HUMAN	Disease (XHED)	---	E/F/G	F	302	S
22	UniProt	VAR_075316	Y	304	H	EDA_HUMAN	Unclassified (XHED)	---	E/F/G	Y	304	H
23	UniProt	VAR_054467	Q	306	H	EDA_HUMAN	Disease (XHED)	---	E/F/G	Q	306	H
24	UniProt	VAR_054468	V	307	G	EDA_HUMAN	Disease (XHED)	---	E/F/G	V	307	G
25	UniProt	VAR_075317	D	316	E	EDA_HUMAN	Unclassified (XHED)	---	E/F/G	D	316	E
26	UniProt	VAR_067319	S	319	R	EDA_HUMAN	Disease (XHED)	---	E/F/G	S	319	R
27	UniProt	VAR_054469	Y	320	C	EDA_HUMAN	Disease (XHED)	---	E/F/G	Y	320	C
28	UniProt	VAR_064867	V	323	G	EDA_HUMAN	Disease (XHED)	---	E/F/G	V	323	G
29	UniProt	VAR_075318	C	332	F	EDA_HUMAN	Unclassified (XHED)	---	E/F/G	C	332	F
30	UniProt	VAR_011080	C	332	Y	EDA_HUMAN	Disease (XHED)	---	E/F/G	C	332	Y
31	UniProt	VAR_071458	R	334	H	EDA_HUMAN	Disease (STHAGX1)	142948132	E/F/G	R	334	H
32	UniProt	VAR_064868	T	338	M	EDA_HUMAN	Disease (STHAGX1)	132630321	E/F/G	T	338	M
33	UniProt	VAR_054470	Y	343	C	EDA_HUMAN	Disease (XHED)	---	E/F/G	Y	343	C
34	UniProt	VAR_064869	C	346	Y	EDA_HUMAN	Disease (XHED)	---	E/F/G	C	346	Y
35	UniProt	VAR_005189	A	349	T	EDA_HUMAN	Disease (XHED)	132630317	E/F/G	A	349	T
36	UniProt	VAR_075319	G	350	D	EDA_HUMAN	Unclassified (XHED)	---	E/F/G	G	350	D
37	UniProt	VAR_067250	L	354	P	EDA_HUMAN	Disease (XHED)	---	E/F/G	L	354	P
38	UniProt	VAR_005190	A	356	D	EDA_HUMAN	Disease (XHED)	---	E/F/G	A	356	D
39	UniProt	VAR_064870	A	356	V	EDA_HUMAN	Disease (XHED)	876657639	E/F/G	A	356	V
40	UniProt	VAR_005191	R	357	P	EDA_HUMAN	Disease (XHED)	---	E/F/G	R	357	P
41	UniProt	VAR_054471	Q	358	E	EDA_HUMAN	Disease (XHED)	132630320	E/F/G	Q	358	E
42	UniProt	VAR_075320	Q	358	H	EDA_HUMAN	Unclassified (XHED)	---	E/F/G	Q	358	H
43	UniProt	VAR_054472	I	360	N	EDA_HUMAN	Disease (XHED)	---	E/F/G	I	360	N
44	UniProt	VAR_054473	N	372	D	EDA_HUMAN	Disease (XHED)	---	E/F/G	N	372	D
45	UniProt	VAR_054474	M	373	I	EDA_HUMAN	Disease (XHED)	---	E/F/G	M	373	I
46	UniProt	VAR_054475	S	374	R	EDA_HUMAN	Disease (XHED)	---	E/F/G	S	374	R
47	UniProt	VAR_013488	T	378	M	EDA_HUMAN	Disease (XHED)	---	E/F/G	T	378	M
48	UniProt	VAR_054476	T	378	P	EDA_HUMAN	Disease (XHED)	---	E/F/G	T	378	P
49	UniProt	VAR_071459	F	379	V	EDA_HUMAN	Disease (STHAGX1)	---	E/F/G	F	379	V
50	UniProt	VAR_064871	G	381	R	EDA_HUMAN	Disease (XHED)	---	E/F/G	G	381	R
51	UniProt	VAR_075321	G	381	V	EDA_HUMAN	Unclassified (XHED)	---	E/F/G	G	381	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (51, 153)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_005187	H	252	L	EDA_HUMAN	Disease (XHED)	879255552	H/I/J	H	252	L
02	UniProt	VAR_013485	H	252	Y	EDA_HUMAN	Disease (XHED)	---	H/I/J	H	252	Y
03	UniProt	VAR_011077	G	255	C	EDA_HUMAN	Disease (XHED)	---	H/I/J	G	255	C
04	UniProt	VAR_011078	G	255	D	EDA_HUMAN	Disease (XHED)	---	H/I/J	G	255	D
05	UniProt	VAR_071454	A	259	E	EDA_HUMAN	Disease (STHAGX1)	879255611	H/I/J	A	259	E
06	UniProt	VAR_071455	I	260	S	EDA_HUMAN	Disease (STHAGX1)	---	H/I/J	I	260	S
07	UniProt	VAR_064862	L	266	R	EDA_HUMAN	Disease (XHED)	---	H/I/J	L	266	R
08	UniProt	VAR_013486	G	269	V	EDA_HUMAN	Disease (XHED)	---	H/I/J	G	269	V
09	UniProt	VAR_011079	W	274	G	EDA_HUMAN	Disease (XHED)	---	H/I/J	W	274	G
10	UniProt	VAR_064863	W	274	R	EDA_HUMAN	Disease (XHED)	---	H/I/J	W	274	R
11	UniProt	VAR_071456	R	289	C	EDA_HUMAN	Disease (STHAGX1)	879255551	H/I/J	R	289	C
12	UniProt	VAR_071457	R	289	L	EDA_HUMAN	Disease (STHAGX1)	---	H/I/J	R	289	L
13	UniProt	VAR_010613	G	291	R	EDA_HUMAN	Disease (XHED)	397516677	H/I/J	G	291	R
14	UniProt	VAR_010614	G	291	W	EDA_HUMAN	Disease (XHED)	---	H/I/J	G	291	W
15	UniProt	VAR_064864	L	293	P	EDA_HUMAN	Disease (XHED)	---	H/I/J	L	293	P
16	UniProt	VAR_064865	L	296	V	EDA_HUMAN	Disease (XHED)	---	H/I/J	L	296	V
17	UniProt	VAR_010615	D	298	H	EDA_HUMAN	Disease (XHED)	---	H/I/J	D	298	H
18	UniProt	VAR_054466	D	298	Y	EDA_HUMAN	Disease (XHED)	---	H/I/J	D	298	Y
19	UniProt	VAR_064866	G	299	D	EDA_HUMAN	Disease (XHED)	---	H/I/J	G	299	D
20	UniProt	VAR_005188	G	299	S	EDA_HUMAN	Disease (XHED)	397516679	H/I/J	G	299	S
21	UniProt	VAR_013487	F	302	S	EDA_HUMAN	Disease (XHED)	---	H/I/J	F	302	S
22	UniProt	VAR_075316	Y	304	H	EDA_HUMAN	Unclassified (XHED)	---	H/I/J	Y	304	H
23	UniProt	VAR_054467	Q	306	H	EDA_HUMAN	Disease (XHED)	---	H/I/J	Q	306	H
24	UniProt	VAR_054468	V	307	G	EDA_HUMAN	Disease (XHED)	---	H/I/J	V	307	G
25	UniProt	VAR_075317	D	316	E	EDA_HUMAN	Unclassified (XHED)	---	H/I/J	D	316	E
26	UniProt	VAR_067319	S	319	R	EDA_HUMAN	Disease (XHED)	---	H/I/J	S	319	R
27	UniProt	VAR_054469	Y	320	C	EDA_HUMAN	Disease (XHED)	---	H/I/J	Y	320	C
28	UniProt	VAR_064867	V	323	G	EDA_HUMAN	Disease (XHED)	---	H/I/J	V	323	G
29	UniProt	VAR_075318	C	332	F	EDA_HUMAN	Unclassified (XHED)	---	H/I/J	C	332	F
30	UniProt	VAR_011080	C	332	Y	EDA_HUMAN	Disease (XHED)	---	H/I/J	C	332	Y
31	UniProt	VAR_071458	R	334	H	EDA_HUMAN	Disease (STHAGX1)	142948132	H/I/J	R	334	H
32	UniProt	VAR_064868	T	338	M	EDA_HUMAN	Disease (STHAGX1)	132630321	H/I/J	T	338	M
33	UniProt	VAR_054470	Y	343	C	EDA_HUMAN	Disease (XHED)	---	H/I/J	Y	343	C
34	UniProt	VAR_064869	C	346	Y	EDA_HUMAN	Disease (XHED)	---	H/I/J	C	346	Y
35	UniProt	VAR_005189	A	349	T	EDA_HUMAN	Disease (XHED)	132630317	H/I/J	A	349	T
36	UniProt	VAR_075319	G	350	D	EDA_HUMAN	Unclassified (XHED)	---	H/I/J	G	350	D
37	UniProt	VAR_067250	L	354	P	EDA_HUMAN	Disease (XHED)	---	H/I/J	L	354	P
38	UniProt	VAR_005190	A	356	D	EDA_HUMAN	Disease (XHED)	---	H/I/J	A	356	D
39	UniProt	VAR_064870	A	356	V	EDA_HUMAN	Disease (XHED)	876657639	H/I/J	A	356	V
40	UniProt	VAR_005191	R	357	P	EDA_HUMAN	Disease (XHED)	---	H/I/J	R	357	P
41	UniProt	VAR_054471	Q	358	E	EDA_HUMAN	Disease (XHED)	132630320	H/I/J	Q	358	E
42	UniProt	VAR_075320	Q	358	H	EDA_HUMAN	Unclassified (XHED)	---	H/I/J	Q	358	H
43	UniProt	VAR_054472	I	360	N	EDA_HUMAN	Disease (XHED)	---	H/I/J	I	360	N
44	UniProt	VAR_054473	N	372	D	EDA_HUMAN	Disease (XHED)	---	H/I/J	N	372	D
45	UniProt	VAR_054474	M	373	I	EDA_HUMAN	Disease (XHED)	---	H/I/J	M	373	I
46	UniProt	VAR_054475	S	374	R	EDA_HUMAN	Disease (XHED)	---	H/I/J	S	374	R
47	UniProt	VAR_013488	T	378	M	EDA_HUMAN	Disease (XHED)	---	H/I/J	T	378	M
48	UniProt	VAR_054476	T	378	P	EDA_HUMAN	Disease (XHED)	---	H/I/J	T	378	P
49	UniProt	VAR_071459	F	379	V	EDA_HUMAN	Disease (STHAGX1)	---	H/I/J	F	379	V
50	UniProt	VAR_064871	G	381	R	EDA_HUMAN	Disease (XHED)	---	H/I/J	G	381	R
51	UniProt	VAR_075321	G	381	V	EDA_HUMAN	Unclassified (XHED)	---	H/I/J	G	381	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 4 (51, 153)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_005187	H	252	L	EDA_HUMAN	Disease (XHED)	879255552	K/L/M	H	252	L
02	UniProt	VAR_013485	H	252	Y	EDA_HUMAN	Disease (XHED)	---	K/L/M	H	252	Y
03	UniProt	VAR_011077	G	255	C	EDA_HUMAN	Disease (XHED)	---	K/L/M	G	255	C
04	UniProt	VAR_011078	G	255	D	EDA_HUMAN	Disease (XHED)	---	K/L/M	G	255	D
05	UniProt	VAR_071454	A	259	E	EDA_HUMAN	Disease (STHAGX1)	879255611	K/L/M	A	259	E
06	UniProt	VAR_071455	I	260	S	EDA_HUMAN	Disease (STHAGX1)	---	K/L/M	I	260	S
07	UniProt	VAR_064862	L	266	R	EDA_HUMAN	Disease (XHED)	---	K/L/M	L	266	R
08	UniProt	VAR_013486	G	269	V	EDA_HUMAN	Disease (XHED)	---	K/L/M	G	269	V
09	UniProt	VAR_011079	W	274	G	EDA_HUMAN	Disease (XHED)	---	K/L/M	W	274	G
10	UniProt	VAR_064863	W	274	R	EDA_HUMAN	Disease (XHED)	---	K/L/M	W	274	R
11	UniProt	VAR_071456	R	289	C	EDA_HUMAN	Disease (STHAGX1)	879255551	K/L/M	R	289	C
12	UniProt	VAR_071457	R	289	L	EDA_HUMAN	Disease (STHAGX1)	---	K/L/M	R	289	L
13	UniProt	VAR_010613	G	291	R	EDA_HUMAN	Disease (XHED)	397516677	K/L/M	G	291	R
14	UniProt	VAR_010614	G	291	W	EDA_HUMAN	Disease (XHED)	---	K/L/M	G	291	W
15	UniProt	VAR_064864	L	293	P	EDA_HUMAN	Disease (XHED)	---	K/L/M	L	293	P
16	UniProt	VAR_064865	L	296	V	EDA_HUMAN	Disease (XHED)	---	K/L/M	L	296	V
17	UniProt	VAR_010615	D	298	H	EDA_HUMAN	Disease (XHED)	---	K/L/M	D	298	H
18	UniProt	VAR_054466	D	298	Y	EDA_HUMAN	Disease (XHED)	---	K/L/M	D	298	Y
19	UniProt	VAR_064866	G	299	D	EDA_HUMAN	Disease (XHED)	---	K/L/M	G	299	D
20	UniProt	VAR_005188	G	299	S	EDA_HUMAN	Disease (XHED)	397516679	K/L/M	G	299	S
21	UniProt	VAR_013487	F	302	S	EDA_HUMAN	Disease (XHED)	---	K/L/M	F	302	S
22	UniProt	VAR_075316	Y	304	H	EDA_HUMAN	Unclassified (XHED)	---	K/L/M	Y	304	H
23	UniProt	VAR_054467	Q	306	H	EDA_HUMAN	Disease (XHED)	---	K/L/M	Q	306	H
24	UniProt	VAR_054468	V	307	G	EDA_HUMAN	Disease (XHED)	---	K/L/M	V	307	G
25	UniProt	VAR_075317	D	316	E	EDA_HUMAN	Unclassified (XHED)	---	K/L/M	D	316	E
26	UniProt	VAR_067319	S	319	R	EDA_HUMAN	Disease (XHED)	---	K/L/M	S	319	R
27	UniProt	VAR_054469	Y	320	C	EDA_HUMAN	Disease (XHED)	---	K/L/M	Y	320	C
28	UniProt	VAR_064867	V	323	G	EDA_HUMAN	Disease (XHED)	---	K/L/M	V	323	G
29	UniProt	VAR_075318	C	332	F	EDA_HUMAN	Unclassified (XHED)	---	K/L/M	C	332	F
30	UniProt	VAR_011080	C	332	Y	EDA_HUMAN	Disease (XHED)	---	K/L/M	C	332	Y
31	UniProt	VAR_071458	R	334	H	EDA_HUMAN	Disease (STHAGX1)	142948132	K/L/M	R	334	H
32	UniProt	VAR_064868	T	338	M	EDA_HUMAN	Disease (STHAGX1)	132630321	K/L/M	T	338	M
33	UniProt	VAR_054470	Y	343	C	EDA_HUMAN	Disease (XHED)	---	K/L/M	Y	343	C
34	UniProt	VAR_064869	C	346	Y	EDA_HUMAN	Disease (XHED)	---	K/L/M	C	346	Y
35	UniProt	VAR_005189	A	349	T	EDA_HUMAN	Disease (XHED)	132630317	K/L/M	A	349	T
36	UniProt	VAR_075319	G	350	D	EDA_HUMAN	Unclassified (XHED)	---	K/L/M	G	350	D
37	UniProt	VAR_067250	L	354	P	EDA_HUMAN	Disease (XHED)	---	K/L/M	L	354	P
38	UniProt	VAR_005190	A	356	D	EDA_HUMAN	Disease (XHED)	---	K/L/M	A	356	D
39	UniProt	VAR_064870	A	356	V	EDA_HUMAN	Disease (XHED)	876657639	K/L/M	A	356	V
40	UniProt	VAR_005191	R	357	P	EDA_HUMAN	Disease (XHED)	---	K/L/M	R	357	P
41	UniProt	VAR_054471	Q	358	E	EDA_HUMAN	Disease (XHED)	132630320	K/L/M	Q	358	E
42	UniProt	VAR_075320	Q	358	H	EDA_HUMAN	Unclassified (XHED)	---	K/L/M	Q	358	H
43	UniProt	VAR_054472	I	360	N	EDA_HUMAN	Disease (XHED)	---	K/L/M	I	360	N
44	UniProt	VAR_054473	N	372	D	EDA_HUMAN	Disease (XHED)	---	K/L/M	N	372	D
45	UniProt	VAR_054474	M	373	I	EDA_HUMAN	Disease (XHED)	---	K/L/M	M	373	I
46	UniProt	VAR_054475	S	374	R	EDA_HUMAN	Disease (XHED)	---	K/L/M	S	374	R
47	UniProt	VAR_013488	T	378	M	EDA_HUMAN	Disease (XHED)	---	K/L/M	T	378	M
48	UniProt	VAR_054476	T	378	P	EDA_HUMAN	Disease (XHED)	---	K/L/M	T	378	P
49	UniProt	VAR_071459	F	379	V	EDA_HUMAN	Disease (STHAGX1)	---	K/L/M	F	379	V
50	UniProt	VAR_064871	G	381	R	EDA_HUMAN	Disease (XHED)	---	K/L/M	G	381	R
51	UniProt	VAR_075321	G	381	V	EDA_HUMAN	Unclassified (XHED)	---	K/L/M	G	381	V

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 12)

Exons (4, 47)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:144
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:144
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386    
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7a_ A: Ectodysplasin A, Eda-a1                                                                                                               SCOP domains
               CATH domains 1rj7A00 A:247-390  [code=2.60.120.40, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee....eehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeee.....eeeeeee..eeeeeeee.........eeeeeeeeeee....eeeeee....eeee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: A:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: A:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: A:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 A 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain B from PDB  Type:PROTEIN  Length:144
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:144
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386    
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7b_ B: Ectodysplasin A, Eda-a1                                                                                                               SCOP domains
               CATH domains 1rj7B00 B:247-390  [code=2.60.120.40, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee...eeehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeee....eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee....eeee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: B:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: B:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: B:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 B 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain D from PDB  Type:PROTEIN  Length:144
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:144
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386    
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7d_ D: Ectodysplasin A, Eda-a1                                                                                                               SCOP domains
               CATH domains 1rj7D00 D:247-390  [code=2.60.120.40, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee...eeehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeee.....eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee.....eee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: D:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: D:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: D:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 D 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain E from PDB  Type:PROTEIN  Length:149
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:149
                                   251       261       271       281       291       301       311       321       331       341       351       361       371       381         
            EDA_HUMAN   242 GTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7e_ E: Ectodysplasin A, Eda-a1                                                                                                                    SCOP domains
               CATH domains 1rj7E00 E:242-390  [code=2.60.120.40, no name defined]                                                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......eeeeeee....eehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeeee...eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee...eeee.......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) ----------L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----------Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE --------TNF_2  PDB: E:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1.14  Exon 1.15         -------------------------------------------Exon 1.17b  PDB: E:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.16c  PDB: E:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 E 242 GTRENQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   251       261       271       281       291       301       311       321       331       341       351       361       371       381

Chain F from PDB  Type:PROTEIN  Length:144
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:144
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386    
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7f_ F: Ectodysplasin A, Eda-a1                                                                                                               SCOP domains
               CATH domains 1rj7F00 F:247-390  [code=2.60.120.40, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee..eeeehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeeee...eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee...eeeeee.....eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: F:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: F:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: F:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 F 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain G from PDB  Type:PROTEIN  Length:144
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:144
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386    
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7g_ G: Ectodysplasin A, Eda-a1                                                                                                               SCOP domains
               CATH domains 1rj7G00 G:247-390  [code=2.60.120.40, no name defined]                                                                                           CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..eeeeeee...eeehhhhh.......eeeeee....eee......eee...eeeeeeeeeeeeee.....eeeeeee..eeeeeeee.........eeeeeeeeeee....eeeeee....eeee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: G:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: G:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: G:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 G 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain H from PDB  Type:PROTEIN  Length:142
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:142
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386  
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEA 388
               SCOP domains d1rj7h_ H: Ectodysplasin A, Eda-a1                                                                                                             SCOP domains
               CATH domains 1rj7H00 H:247-388  [code=2.60.120.40, no name defined]                                                                                         CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...eeehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeeee...eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee...eeeee......eeeeeeee.. Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: H:250-385 UniProt: 250-385                                                                                                  --- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: H:309-388 UniProt: 309-391 [INCOMPLETE]                         Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: H:265-308 UniProt: 265-308 -------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 H 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEA 388
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain I from PDB  Type:PROTEIN  Length:143
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:143
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386   
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAP 389
               SCOP domains d1rj7i_ I: Ectodysplasin A, Eda-a1                                                                                                              SCOP domains
               CATH domains 1rj7I00 I:247-389  [code=2.60.120.40, no name defined]                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....eehhhhhhhhh...eeeeee....eeee....eeee...eeeeeeeeeeeeeee....eeeeeee..eeeeeeee.........eeeeeeeeeee....eeeeee...eeeee......eeeeeeee... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R-------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V-------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: I:250-385 UniProt: 250-385                                                                                                  ---- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: I:309-389 UniProt: 309-391 [INCOMPLETE]                          Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: I:265-308 UniProt: 265-308 --------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 I 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAP 389
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain J from PDB  Type:PROTEIN  Length:143
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:143
                                   257       267       277       287       297       307       317       327       337       347       357       367       377       387   
            EDA_HUMAN   248 PAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7j_ J: Ectodysplasin A, Eda-a1                                                                                                              SCOP domains
               CATH domains 1rj7J00 J:248-390  [code=2.60.120.40, no name defined]                                                                                          CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....eeehhhhh.................eeee....eeee...eeeeeeeeeeeeeee...eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee...eeeee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) ----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE --TNF_2  PDB: J:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) Exon 1.15         -------------------------------------------Exon 1.17b  PDB: J:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) -----------------Exon 1.16c  PDB: J:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 J 248 PAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   257       267       277       287       297       307       317       327       337       347       357       367       377       387

Chain K from PDB  Type:PROTEIN  Length:145
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:145
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386     
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS 391
               SCOP domains d1rj7k_ K: Ectodysplasin A, Eda-a1                                                                                                                SCOP domains
               CATH domains 1rj7K00 K:247-391  [code=2.60.120.40, no name defined]                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee...eeehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeee.....eeeeeee..eeeeeeee.........eeeeeeeeeee....eeeeee....eeee......eeeeeeee..... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R---------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V---------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: K:250-385 UniProt: 250-385                                                                                                  ------ PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: K:309-391 UniProt: 309-391                                         Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: K:265-308 UniProt: 265-308 ----------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 K 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPAS 391
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Chain L from PDB  Type:PROTEIN  Length:145
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:145
                                   255       265       275       285       295       305       315       325       335       345       355       365       375       385     
            EDA_HUMAN   246 NQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7l_ L: Ectodysplasin A, Eda-a1                                                                                                                SCOP domains
               CATH domains 1rj7L00 L:246-390  [code=2.60.120.40, no name defined]                                                                                            CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeee...eeehhhhh.......eeeeee....eeee....eeee...eeeeeeeeeeeeeee...eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee...eeeee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) ------L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ------Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ----TNF_2  PDB: L:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1.Exon 1.15         -------------------------------------------Exon 1.17b  PDB: L:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) -------------------Exon 1.16c  PDB: L:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 L 246 NQPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   255       265       275       285       295       305       315       325       335       345       355       365       375       385

Chain M from PDB  Type:PROTEIN  Length:144
 aligned with EDA_HUMAN | Q92838 from UniProtKB/Swiss-Prot  Length:391

    Alignment length:144
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386    
            EDA_HUMAN   247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
               SCOP domains d1rj7m_ M: Ectodysplasin A, Eda-a1                                                                                                               SCOP domains
               CATH domains 1rj7M00 M:247-390  [code=2.60.120.40, no name defined]                                                                                           CATH domains
           Pfam domains (1) -------------------------TNF-1rj7M01 M:272-385                                                                                             ----- Pfam domains (1)
           Pfam domains (2) -------------------------TNF-1rj7M02 M:272-385                                                                                             ----- Pfam domains (2)
           Pfam domains (3) -------------------------TNF-1rj7M03 M:272-385                                                                                             ----- Pfam domains (3)
           Pfam domains (4) -------------------------TNF-1rj7M04 M:272-385                                                                                             ----- Pfam domains (4)
           Pfam domains (5) -------------------------TNF-1rj7M05 M:272-385                                                                                             ----- Pfam domains (5)
           Pfam domains (6) -------------------------TNF-1rj7M06 M:272-385                                                                                             ----- Pfam domains (6)
           Pfam domains (7) -------------------------TNF-1rj7M07 M:272-385                                                                                             ----- Pfam domains (7)
           Pfam domains (8) -------------------------TNF-1rj7M08 M:272-385                                                                                             ----- Pfam domains (8)
           Pfam domains (9) -------------------------TNF-1rj7M09 M:272-385                                                                                             ----- Pfam domains (9)
          Pfam domains (10) -------------------------TNF-1rj7M10 M:272-385                                                                                             ----- Pfam domains (10)
          Pfam domains (11) -------------------------TNF-1rj7M11 M:272-385                                                                                             ----- Pfam domains (11)
          Pfam domains (12) -------------------------TNF-1rj7M12 M:272-385                                                                                             ----- Pfam domains (12)
         Sec.struct. author ..eeeeee....eeehhhhh........eeeee....eee......eee...eeeeeeeeeeeeeee...eeeeeeee..eeeeeeeee........eeeeeeeeeee....eeeeee...eeeee......eeeeeeee.... Sec.struct. author
             SAPs(SNPs) (1) -----L--C---ES-----R--V----G--------------C-R-P--V-HD--S-H-HG--------E--RC--G--------F-H---M----C--Y--TD---P-DPE-N-----------DIR---MV-R--------- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----Y--D------------------R--------------L-W------YS--------------------------------Y-----------------------V-H-------------------P--V--------- SAPs(SNPs) (2)
                    PROSITE ---TNF_2  PDB: M:250-385 UniProt: 250-385                                                                                                  ----- PROSITE
           Transcript 1 (1) 1Exon 1.15         -------------------------------------------Exon 1.17b  PDB: M:309-390 UniProt: 309-391 [INCOMPLETE]                           Transcript 1 (1)
           Transcript 1 (2) ------------------Exon 1.16c  PDB: M:265-308 UniProt: 265-308 ---------------------------------------------------------------------------------- Transcript 1 (2)
                 1rj7 M 247 QPAVVHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIYSQVEVYYINFTDFASYEVVVDEKPFLQCTRSIETGKTNYNTCYTAGVCLLKARQKIAVKMVHADISINMSKHTTFFGAIRLGEAPA 390
                                   256       266       276       286       296       306       316       326       336       346       356       366       376       386

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 12)

CATH Domains (1, 12)

Pfam Domains (1, 12)

Gene Ontology (33, 33)

Asymmetric Unit(hide GO term definitions)

Chain A,B,D,E,F,G,H,I,J,K,L,M (EDA_HUMAN | Q92838)

molecular function
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0005164	tumor necrosis factor receptor binding	Interacting selectively and non-covalently with the tumor necrosis factor receptor.
biological process
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0007160	cell-matrix adhesion	The binding of a cell to the extracellular matrix via adhesion molecules.
	GO:0007398	ectoderm development	The process whose specific outcome is the progression of the ectoderm over time, from its formation to the mature structure. In animal embryos, the ectoderm is the outer germ layer of the embryo, formed during gastrulation.
	GO:0010467	gene expression	The process in which a gene's sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0001942	hair follicle development	The process whose specific outcome is the progression of the hair follicle over time, from its formation to the mature structure. A hair follicle is a tube-like opening in the epidermis where the hair shaft develops and into which the sebaceous glands open.
	GO:0060789	hair follicle placode formation	The developmental process in which a hair placode forms. An hair follicle placode is a thickening of the ectoderm that will give rise to the hair follicle bud.
	GO:0006955	immune response	Any immune system process that functions in the calibrated response of an organism to a potential internal or invasive threat.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
	GO:0042475	odontogenesis of dentin-containing tooth	The process whose specific outcome is the progression of a dentin-containing tooth over time, from its formation to the mature structure. A dentin-containing tooth is a hard, bony organ borne on the jaw or other bone of a vertebrate, and is composed mainly of dentin, a dense calcified substance, covered by a layer of enamel.
	GO:0043473	pigmentation	The accumulation of pigment in an organism, tissue or cell, either by increased deposition or by increased number of cells.
	GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	Any process that activates or increases the frequency, rate or extent of I-kappaB kinase/NF-kappaB signaling.
	GO:0042346	positive regulation of NF-kappaB import into nucleus	Any process that activates or increases the frequency, rate or extent of transfer of NF-kappaB, a transcription factor for eukaryotic RNA polymerase II promoters, from the cytoplasm into the nucleus, across the nuclear membrane.
	GO:0051092	positive regulation of NF-kappaB transcription factor activity	Any process that activates or increases the frequency, rate or extent of activity of the transcription factor NF-kappaB.
	GO:0090263	positive regulation of canonical Wnt signaling pathway	Any process that increases the rate, frequency, or extent of the Wnt signaling pathway through beta-catenin, the series of molecular signals initiated by binding of a Wnt protein to a frizzled family receptor on the surface of the target cell, followed by propagation of the signal via beta-catenin, and ending with a change in transcription of target genes.
	GO:0010628	positive regulation of gene expression	Any process that increases the frequency, rate or extent of gene expression. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA or circRNA (for protein-coding genes) and the translation of that mRNA or circRNA into protein. Protein maturation is included when required to form an active form of a product from an inactive precursor form.
	GO:0060662	salivary gland cavitation	The process in which the solid core of salivary epithelium gives rise to the hollow tube of the gland.
	GO:0007165	signal transduction	The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
	GO:0043588	skin development	The process whose specific outcome is the progression of the skin over time, from its formation to the mature structure. The skin is the external membranous integument of an animal. In vertebrates the skin generally consists of two layers, an outer nonsensitive and nonvascular epidermis (cuticle or skarfskin) composed of cells which are constantly growing and multiplying in the deeper, and being thrown off in the superficial layers, as well as an inner vascular dermis (cutis, corium or true skin) composed mostly of connective tissue.
	GO:0061153	trachea gland development	The progression of a trachea gland over time, from its formation to the mature structure. Trachea glands are found under the mucus of the trachea and secrete mucus, and agents that help protect the lung from injury and infection.
	GO:0033209	tumor necrosis factor-mediated signaling pathway	A series of molecular signals initiated by the binding of a tumor necrosis factor to a receptor on the surface of a cell, and ending with regulation of a downstream cellular process, e.g. transcription.
cellular component
	GO:0045177	apical part of cell	The region of a polarized cell that forms a tip or is distal to a base. For example, in a polarized epithelial cell, the apical region has an exposed surface and lies opposite to the basal lamina that separates the epithelium from other tissue.
	GO:0005581	collagen trimer	A protein complex consisting of three collagen chains assembled into a left-handed triple helix. These trimers typically assemble into higher order structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0005576	extracellular region	The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0005887	integral component of plasma membrane	The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005886	plasma membrane	The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (51, 612)

PROSITE Motifs (1, 12)

Exons (4, 47)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 12)

CATH Domains (1, 12)

Pfam Domains (1, 12)

Gene Ontology (33, 33)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File