Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  BACTERIOPHAGE LAMBDA EXCISIONASE (XIS)-DNA COMPLEX
 
Authors :  M. D. Sam, D. Cascio, R. C. Johnson, R. T. Clubb
Date :  13 Nov 03  (Deposition) - 29 Jun 04  (Release) - 09 May 12  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  B,C,D  (1x)
Biol. Unit 2:  A  (1x)
Keywords :  Protein-Dna Complex, Dna Architectural Protein, 'Winged'-Helix Protein, Phage Excision, Site-Specific Dna Recombination, Dna Binding Protein-Dna Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. D. Sam, D. Cascio, R. C. Johnson, R. T. Clubb
Crystal Structure Of The Excisionase-Dna Complex From Bacteriophage Lambda.
J. Mol. Biol. V. 338 229 2004
PubMed-ID: 15066428  |  Reference-DOI: 10.1016/J.JMB.2004.02.053

(-) Compounds

Molecule 1 - 5'-D(*CP*TP*AP*TP*GP*TP*AP*GP*TP*CP*TP*GP*TP*TP*G)-3'
    Chains: C
    Engineered: YES
    Synthetic: YES
 
Molecule 2 - 5'-D(P*CP*AP*AP*CP*AP*GP*AP*CP*TP*AP*CP*AP*TP*AP*G)-3'
    Chains: D
    Engineered: YES
    Synthetic: YES
 
Molecule 3 - EXCISIONASE
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET11A
    Expression System Strain: RJ3386 (BL21-DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: XIS DBD (RESIDUES 1-55)
    Gene: XIS
    Mutation: YES
    Organism Scientific: ENTEROBACTERIA PHAGE LAMBDA
    Organism Taxid: 10710

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x):  BCD
Biological Unit 2 (1x): A   

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1RH6)

(-) Sites  (0, 0)

(no "Site" information available for 1RH6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1RH6)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Phe A:31 -Pro A:32
2Phe B:31 -Pro B:32

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1RH6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1RH6)

(-) Exons   (0, 0)

(no "Exon" information available for 1RH6)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:55
 aligned with VXIS_LAMBD | P03699 from UniProtKB/Swiss-Prot  Length:72

    Alignment length:55
                                    10        20        30        40        50     
            VXIS_LAMBD    1 MYLTLQEWNARQRRPRSLETVRRWVRECRIFPPPVKDGREYLFHESAVKVDLNRP 55
               SCOP domains d1rh6a_ A: Excisionase Xis                              SCOP domains
               CATH domains 1rh6A00 A:1-55  [code=1.10.1660.20, no name defined]    CATH domains
               Pfam domains ------------------------------------------------------- Pfam domains
         Sec.struct. author .eehhhhhhhh.....hhhhhhhhhhh..ee...eee..eeeee...ee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------- Transcript
                  1rh6 A  1 MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDLNRP 55
                                    10        20        30        40        50     


Chain B from PDB  Type:PROTEIN  Length:52
 aligned with VXIS_LAMBD | P03699 from UniProtKB/Swiss-Prot  Length:72

    Alignment length:52
                                    10        20        30        40        50  
            VXIS_LAMBD    1 MYLTLQEWNARQRRPRSLETVRRWVRECRIFPPPVKDGREYLFHESAVKVDL 52
               SCOP domains d1rh6b_ B: Excisionase Xis                           SCOP domains
               CATH domains 1rh6B00 B:1-52  [code=1.10.1660.20, no name defined] CATH domains
           Pfam domains (1) Exc-1rh6B01 B:1-52                                   Pfam domains (1)
           Pfam domains (2) Exc-1rh6B02 B:1-52                                   Pfam domains (2)
         Sec.struct. author .eeehhhhhhhh....hhhhhhhhhhh..ee...eee..eeeee...ee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------- Transcript
                  1rh6 B  1 MYLTLQEWNARQRRPRSLETVRRWVRESRIFPPPVKDGREYLFHESAVKVDL 52
                                    10        20        30        40        50  


Chain C from PDB  Type:DNA  Length:14
                                             
                  1rh6 C  2 TATGTAGTCTGTTG 15
                                    11    


Chain D from PDB  Type:DNA  Length:14
                                             
                  1rh6 D 16 CAACAGACTACATA 29
                                    25
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: HTH (544)

(-) Gene Ontology  (2, 2)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (VXIS_LAMBD | P03699)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
biological process
    GO:0006310    DNA recombination    Any process in which a new genotype is formed by reassortment of genes resulting in gene combinations different from those that were present in the parents. In eukaryotes genetic recombination can occur by chromosome assortment, intrachromosomal recombination, or nonreciprocal interchromosomal recombination. Intrachromosomal recombination occurs by crossing over. In bacteria it may occur by genetic transformation, conjugation, transduction, or F-duction.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1rh6)
 
  Sites
(no "Sites" information available for 1rh6)
 
  Cis Peptide Bonds
    Phe A:31 - Pro A:32   [ RasMol ]  
    Phe B:31 - Pro B:32   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1rh6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  VXIS_LAMBD | P03699
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  VXIS_LAMBD | P03699
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        VXIS_LAMBD | P03699: 1lx8 2ief 2og0 5j0n

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1RH6)