Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE T4 REGA TRANSLATIONAL REGULATOR PROTEIN AT 1.9 ANGSTROMS RESOLUTION
 
Authors :  C. Kang, A. Rich
Date :  11 Jan 95  (Deposition) - 01 Jan 96  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  X,Y
Keywords :  Translational Regulator Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Kang, R. Chan, I. Berger, C. Lockshin, L. Green, L. Gold, A. Rich
Crystal Structure Of The T4 Rega Translational Regulator Protein At 1. 9 A Resolution.
Science V. 268 1170 1995
PubMed-ID: 7761833
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - T4 REGA
    ChainsX, Y
    Organism ScientificENTEROBACTERIA PHAGE T4
    Organism Taxid10665

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit XY

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1REG)

(-) Sites  (0, 0)

(no "Site" information available for 1REG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1REG)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1REG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1REG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1REG)

(-) Exons   (0, 0)

(no "Exon" information available for 1REG)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain X from PDB  Type:PROTEIN  Length:122
 aligned with REGA_BPT4 | P69702 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:122
                                    10        20        30        40        50        60        70        80        90       100       110       120  
            REGA_BPT4     1 MIEITLKKPEDFLKVKETLTRMGIANNKDKVLYQSCHILQKKGLYYIVHFKEMLRMDGRQVEMTEEDEVRRDSIAWLLEDWGLIEIVPGQRTFMKDLTNNFRVISFKQKHEWKLVPKYTIGN 122
               SCOP domains d1regx_ X: Translational regulator protein regA                                                                            SCOP domains
               CATH domains 1regX00 X:1-122  [code=3.30.70.650, no name defined]                                                                       CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eee....hhhhhhhhhhhhh..eee....eeee.eeeeee..eeeeeehhhhhhhh.......hhhhhhhhhhhhhhhh..........eee...............hhh.eeeehhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 1reg X   1 MIEITLKKPEDFLKVKETLTRMGIANNKDKVLYQSCHILQKKGLYYIVHFKEMLRMDGRQVEMTEEDEVRRDSIAWLLEDWGLIEIVPGQRTFMKDLTNNFRVISFKQKHEWKLVPKYTIGN 122
                                    10        20        30        40        50        60        70        80        90       100       110       120  

Chain Y from PDB  Type:PROTEIN  Length:120
 aligned with REGA_BPT4 | P69702 from UniProtKB/Swiss-Prot  Length:122

    Alignment length:120
                                    10        20        30        40        50        60        70        80        90       100       110       120
            REGA_BPT4     1 MIEITLKKPEDFLKVKETLTRMGIANNKDKVLYQSCHILQKKGLYYIVHFKEMLRMDGRQVEMTEEDEVRRDSIAWLLEDWGLIEIVPGQRTFMKDLTNNFRVISFKQKHEWKLVPKYTI 120
               SCOP domains d1regy_ Y: Translational regulator protein regA                                                                          SCOP domains
               CATH domains 1regY00 Y:1-120  [code=3.30.70.650, no name defined]                                                                     CATH domains
           Pfam domains (1) Translat_reg-1regY01 Y:1-120                                                                                             Pfam domains (1)
           Pfam domains (2) Translat_reg-1regY02 Y:1-120                                                                                             Pfam domains (2)
         Sec.struct. author .eee....hhhhhhhhhhhhh.eeee....eeee.eeeeee..eeeeeehhhhhhhh.......hhhhhhhhhhhhhhhh..........eee...............hhh.eeee.... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------ Transcript
                 1reg Y   1 MIEITLKKPEDFLKVKETLTRMGIANNKDKVLYQSCHILQKKGLYYIVHFKEMLRMDGRQVEMTEEDEVRRDSIAWLLEDWGLIEIVPGQRTFMKDLTNNFRVISFKQKHEWKLVPKYTI 120
                                    10        20        30        40        50        60        70        80        90       100       110       120

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit

(-) Gene Ontology  (2, 2)

Asymmetric/Biological Unit(hide GO term definitions)
Chain X,Y   (REGA_BPT4 | P69702)
molecular function
    GO:0003723    RNA binding    Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
biological process
    GO:0006417    regulation of translation    Any process that modulates the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of proteins by the translation of mRNA or circRNA.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1reg)
 
  Sites
(no "Sites" information available for 1reg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1reg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
Insightii
  ribbon, secondary structure
Setor
  ribbon, chain-specific coloring, water
  spacefill
  ribbon, sticks
Distance Plot
  representative atom: CA

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1reg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  REGA_BPT4 | P69702
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  REGA_BPT4 | P69702
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1REG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1REG)