|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 1R6Y) |
(no "Site" information available for 1R6Y) |
(no "SS Bond" information available for 1R6Y) |
(no "Cis Peptide Bond" information available for 1R6Y) |
(no "SAP(SNP)/Variant" information available for 1R6Y) |
Asymmetric Unit (1, 1)
|
(no "Exon" information available for 1R6Y) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:103 aligned with YGIN_ECO57 | P0ADU3 from UniProtKB/Swiss-Prot Length:104 Alignment length:103 10 20 30 40 50 60 70 80 90 100 YGIN_ECO57 1 MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG 103 SCOP domains d1r6ya_ A: Hypothetical protein YgiN SCOP domains CATH domains 1r6yA00 A:1-103 [code=3.30.70.900, no name defined] CATH domains Pfam domains ABM-1r6yA01 A:1-87 ---------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) ------------------------------------------------------------------------------------------------------- PROSITE (2) PROSITE (3) -ABM PDB: A:2-100 UniProt: 2-100 --- PROSITE (3) Transcript ------------------------------------------------------------------------------------------------------- Transcript 1r6y A 1 MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG 103 10 20 30 40 50 60 70 80 90 100 Chain A from PDB Type:PROTEIN Length:103 aligned with YGIN_ECOLI | P0ADU2 from UniProtKB/Swiss-Prot Length:104 Alignment length:103 10 20 30 40 50 60 70 80 90 100 YGIN_ECOLI 1 MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG 103 SCOP domains d1r6ya_ A: Hypothetical protein YgiN SCOP domains CATH domains 1r6yA00 A:1-103 [code=3.30.70.900, no name defined] CATH domains Pfam domains ABM-1r6yA01 A:1-87 ---------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -ABM PDB: A:2-100 UniProt: 2-100 --- PROSITE Transcript ------------------------------------------------------------------------------------------------------- Transcript 1r6y A 1 MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG 103 10 20 30 40 50 60 70 80 90 100 Chain A from PDB Type:PROTEIN Length:103 aligned with YGIN_SHIFL | P0ADU4 from UniProtKB/Swiss-Prot Length:104 Alignment length:103 10 20 30 40 50 60 70 80 90 100 YGIN_SHIFL 1 MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG 103 SCOP domains d1r6ya_ A: Hypothetical protein YgiN SCOP domains CATH domains 1r6yA00 A:1-103 [code=3.30.70.900, no name defined] CATH domains Pfam domains ABM-1r6yA01 A:1-87 ---------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE (2) -ABM PDB: A:2-100 UniProt: 2-100 --- PROSITE (2) Transcript ------------------------------------------------------------------------------------------------------- Transcript 1r6y A 1 MLTVIAEIRTRPGQHHRQAVLDQFAKIVPTVLKEEGCHGYAPMVDCAAGVSFQSMAPDSIVMIEQWESIAHLEAHLQTPHMKAYSEAVKGDVLEMNIRILQPG 103 10 20 30 40 50 60 70 80 90 100
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit(hide GO term definitions) Chain A (YGIN_SHIFL | P0ADU4)
Chain A (YGIN_ECO57 | P0ADU3)
Chain A (YGIN_ECOLI | P0ADU2)
|
|
|
|
|
|
|