|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 1R6E) |
Sites (0, 0)| (no "Site" information available for 1R6E) |
SS Bonds (0, 0)| (no "SS Bond" information available for 1R6E) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1R6E) |
SAPs(SNPs)/Variants (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 1R6E) |
Exons (0, 0)| (no "Exon" information available for 1R6E) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:168 aligned with SOPE2_SALTY | Q7CQD4 from UniProtKB/Swiss-Prot Length:240 Alignment length:168 82 92 102 112 122 132 142 152 162 172 182 192 202 212 222 232 SOPE2_SALTY 73 EGRAVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISKGVSITPFLKEIGEAAQNAGLPGEIKNGVFTPGGAGANPFVVPLIASASIKYPHMFINHNQQVSFKAYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS 240 SCOP domains d1r6ea_ A: Effector protein SopE2 SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ---SopE_GEF-1r6eA01 A:76-240 Pfam domains SAPs(SNPs) ----------------------------------------------------H------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 1r6e A 73 EGRAVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISKGVSITPFLKEIGEAAQNAGLPGEIKNGVFTPGGAGANPFVVPLIASASIKYPHMFINHNQQVSFKAYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS 240 82 92 102 112 122 132 142 152 162 172 182 192 202 212 222 232
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 1R6E) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (7, 7)|
NMR Structure(hide GO term definitions) Chain A (SOPE2_SALTY | Q7CQD4)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|