1R4W - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF MITOCHONDRIAL CLASS KAPPA GLUTATHIONE TRANSFERASE

Authors :   J. E. Ladner, J. F. Parsons, C. L. Rife, G. L. Gilliland, R. N. Armstrong

Date :   08 Oct 03 (Deposition) - 03 Feb 04 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Glutathione-S-Transferase, Glutathione Transferase, Kappa Gst, Rgstk1-1 (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. E. Ladner, J. F. Parsons, C. L. Rife, G. L. Gilliland, R. N. Armstrong
Parallel Evolutionary Pathways For Glutathione Transferases: Structure And Mechanism Of The Mitochondrial Class Kappa Enzyme Rgstk1-1
Biochemistry V. 43 352 2004
PubMed-ID: 14717589 | Reference-DOI: 10.1021/BI035832Z
(for further references see the PDB file header)

Molecule 1 - GLUTATHIONE S-TRANSFERASE, MITOCHONDRIAL
	Chains	:	A, B, C, D
	EC Number	:	2.5.1.18
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET-20B
	Expression System Strain	:	BL21(DE3)PLYSS
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Gene	:	GSGSTK1-1
	Organism Common	:	NORWAY RAT
	Organism Scientific	:	RATTUS NORVEGICUS
	Organism Taxid	:	10116
	Synonym	:	GST 13-13, GLUTATHIONE S-TRANSFERASE SUBUNIT 13, GST CLASS-KAPPA

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	GSH	4	Ligand/Ion	GLUTATHIONE

Biological Unit 1 (1, 2)

No.	Name	Count	Type	Full Name
1	GSH	2	Ligand/Ion	GLUTATHIONE

Biological Unit 2 (1, 2)

No.	Name	Count	Type	Full Name
1	GSH	2	Ligand/Ion	GLUTATHIONE

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER A:16 , PRO A:17 , TYR A:18 , ASN A:53 , PHE A:181 , GLY A:182 , LEU A:183 , PHE A:198 , GLY A:199 , SER A:200 , ASP A:201 , LYS B:62 , ARG B:202	BINDING SITE FOR RESIDUE GSH A 301
2	AC2	SOFTWARE	LYS A:62 , ARG A:202 , SER B:16 , PRO B:17 , TYR B:18 , LEU B:44 , MET B:48 , ASN B:53 , GLY B:182 , LEU B:183 , PHE B:198 , GLY B:199 , SER B:200 , ASP B:201 , HOH B:560 , HOH B:669	BINDING SITE FOR RESIDUE GSH B 401
3	AC3	SOFTWARE	SER C:16 , PRO C:17 , TYR C:18 , GLY C:182 , LEU C:183 , SER C:200 , ASP C:201 , HOH C:765 , LYS D:62 , ARG D:202	BINDING SITE FOR RESIDUE GSH C 801
4	AC4	SOFTWARE	LYS C:62 , ARG C:202 , SER D:16 , PRO D:17 , TYR D:18 , MET D:48 , PHE D:181 , GLY D:182 , LEU D:183 , PHE D:198 , GLY D:199 , SER D:200 , ASP D:201 , HOH D:763	BINDING SITE FOR RESIDUE GSH D 901

(no "SS Bond" information available for 1R4W)

Asymmetric Unit

No.	Residues
1	Leu A:183	-	Pro A:184
2	Leu B:183	-	Pro B:184
3	Leu C:183	-	Pro C:184
4	Leu D:183	-	Pro D:184

(no "SAP(SNP)/Variant" information available for 1R4W)

(no "PROSITE Motif" information available for 1R4W)

Asymmetric Unit (8, 32)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENSRNOT00000022275	1	ENSRNOE00000157423	chr4:69999767-69999872	106	GSTK1_RAT	1-24	24	4	A:2-24 B:2-24 C:2-24 D:2-24	23 23 23 23
1.2	ENSRNOT00000022275	2	ENSRNOE00000157567	chr4:70000354-70000435	82	GSTK1_RAT	25-52	28	4	A:25-52 B:25-52 C:25-52 D:25-52	28 28 28 28
1.3	ENSRNOT00000022275	3	ENSRNOE00000157738	chr4:70000620-70000748	129	GSTK1_RAT	52-95	44	4	A:52-95 B:52-95 C:52-95 D:52-95	44 44 44 44
1.4	ENSRNOT00000022275	4	ENSRNOE00000157901	chr4:70001172-70001272	101	GSTK1_RAT	95-128	34	4	A:95-128 B:95-128 C:95-128 D:95-128	34 34 34 34
1.5	ENSRNOT00000022275	5	ENSRNOE00000158062	chr4:70001419-70001454	36	GSTK1_RAT	129-140	12	4	A:129-140 B:129-140 C:129-140 D:129-140	12 12 12 12
1.6	ENSRNOT00000022275	6	ENSRNOE00000158223	chr4:70003032-70003148	117	GSTK1_RAT	141-179	39	4	A:141-179 B:141-179 C:141-179 D:141-179	39 39 39 39
1.7	ENSRNOT00000022275	7	ENSRNOE00000158370	chr4:70003483-70003576	94	GSTK1_RAT	180-211	32	4	A:180-211 B:180-211 C:180-211 D:180-211	32 32 32 32
1.8	ENSRNOT00000022275	8	ENSRNOE00000232407	chr4:70003855-70004086	232	GSTK1_RAT	211-226	16	4	A:211-222 B:211-222 C:211-222 D:211-222	12 12 12 12

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:221
 aligned with GSTK1_RAT | P24473 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221 
            GSTK1_RAT     2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
               SCOP domains d1r4wa_ A: Mitochondrial class kappa glutathione S-transferase                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh......hhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:2-24  Exon 1.2  PDB: A:25-52      ------------------------------------------Exon 1.4  PDB: A:95-128           Exon 1.5    Exon 1.6  PDB: A:141-179               Exon 1.7  PDB: A:180-211        ----------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3  PDB: A:52-95 UniProt: 52-95       -------------------------------------------------------------------------------------------------------------------Exon 1.8     Transcript 1 (2)
                 1r4w A   2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain B from PDB  Type:PROTEIN  Length:221
 aligned with GSTK1_RAT | P24473 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221 
            GSTK1_RAT     2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
               SCOP domains d1r4wb_ B: Mitochondrial class kappa glutathione S-transferase                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:2-24  Exon 1.2  PDB: B:25-52      ------------------------------------------Exon 1.4  PDB: B:95-128           Exon 1.5    Exon 1.6  PDB: B:141-179               Exon 1.7  PDB: B:180-211        ----------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3  PDB: B:52-95 UniProt: 52-95       -------------------------------------------------------------------------------------------------------------------Exon 1.8     Transcript 1 (2)
                 1r4w B   2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain C from PDB  Type:PROTEIN  Length:221
 aligned with GSTK1_RAT | P24473 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221 
            GSTK1_RAT     2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
               SCOP domains d1r4wc_ C: Mitochondrial class kappa glutathione S-transferase                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhh............ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:2-24  Exon 1.2  PDB: C:25-52      ------------------------------------------Exon 1.4  PDB: C:95-128           Exon 1.5    Exon 1.6  PDB: C:141-179               Exon 1.7  PDB: C:180-211        ----------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3  PDB: C:52-95 UniProt: 52-95       -------------------------------------------------------------------------------------------------------------------Exon 1.8     Transcript 1 (2)
                 1r4w C   2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Chain D from PDB  Type:PROTEIN  Length:221
 aligned with GSTK1_RAT | P24473 from UniProtKB/Swiss-Prot  Length:226

    Alignment length:221
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221 
            GSTK1_RAT     2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
               SCOP domains d1r4wd_ D: Mitochondrial class kappa glutathione S-transferase                                                                                                                                                                SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -----DSBA-1r4wD01 D:7-211                                                                                                                                                                                         ----------- Pfam domains (1)
           Pfam domains (2) -----DSBA-1r4wD02 D:7-211                                                                                                                                                                                         ----------- Pfam domains (2)
           Pfam domains (3) -----DSBA-1r4wD03 D:7-211                                                                                                                                                                                         ----------- Pfam domains (3)
           Pfam domains (4) -----DSBA-1r4wD04 D:7-211                                                                                                                                                                                         ----------- Pfam domains (4)
         Sec.struct. author ....eeeeeee...hhhhhhhhhhhhhhh....eeeeeee.hhhhhhhhh.......hhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.......hhhhhhhhhhhh..hhhhhhhhhh...hhhhhhhhhhhhhhhhhh......eeeeee..eeeeee...hhhhhhhhhh........... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:2-24  Exon 1.2  PDB: D:25-52      ------------------------------------------Exon 1.4  PDB: D:95-128           Exon 1.5    Exon 1.6  PDB: D:141-179               Exon 1.7  PDB: D:180-211        ----------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------Exon 1.3  PDB: D:52-95 UniProt: 52-95       -------------------------------------------------------------------------------------------------------------------Exon 1.8     Transcript 1 (2)
                 1r4w D   2 GPAPRVLELFYDVLSPYSWLGFEVLCRYQHLWNIKLKLRPALLAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLFQVPMSVPKDFFGEHVKKGTVNAMRFLTAVSMEQPEMLEKVSRELWMRIWSRDEDITESQNILSAAEKAGMATAQAQHLLNKISTELVKSKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEKWMGPVPPTL 222
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a/b) (23833)

Fold: Thioredoxin fold (994)

Superfamily: Thioredoxin-like (992)

Family: DsbA-like (29)

Protein domain: Mitochondrial class kappa glutathione S-transferase (1)

Norway rat (Rattus norvegicus) [TaxId: 10116] (1)

1a	d1r4wa_	A:
1b	d1r4wb_	B:
1c	d1r4wc_	C:
1d	d1r4wd_	D:

(no "CATH Domain" information available for 1R4W)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Thioredoxin (367)

Family: DSBA (7)

Rattus norvegicus (Rat) (1)

1a	DSBA-1r4wD01	D:7-211
1b	DSBA-1r4wD02	D:7-211
1c	DSBA-1r4wD03	D:7-211
1d	DSBA-1r4wD04	D:7-211

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D (GSTK1_RAT | P24473)

molecular function
	GO:0004602	glutathione peroxidase activity	Catalysis of the reaction: 2 glutathione + hydrogen peroxide = oxidized glutathione + 2 H2O.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0015035	protein disulfide oxidoreductase activity	Catalysis of the reaction: a protein with reduced sulfide groups = a protein with oxidized disulfide bonds.
	GO:0005102	receptor binding	Interacting selectively and non-covalently with one or more specific sites on a receptor molecule, a macromolecule that undergoes combination with a hormone, neurotransmitter, drug or intracellular messenger to initiate a change in cell function.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0098869	cellular oxidant detoxification	Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
	GO:0030855	epithelial cell differentiation	The process in which a relatively unspecialized cell acquires specialized features of an epithelial cell, any of the cells making up an epithelium.
	GO:0006749	glutathione metabolic process	The chemical reactions and pathways involving glutathione, the tripeptide glutamylcysteinylglycine, which acts as a coenzyme for some enzymes and as an antioxidant in the protection of sulfhydryl groups in enzymes and other proteins; it has a specific role in the reduction of hydrogen peroxide (H2O2) and oxidized ascorbate, and it participates in the gamma-glutamyl cycle.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0005622	intracellular	The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.
	GO:0043231	intracellular membrane-bounded organelle	Organized structure of distinctive morphology and function, bounded by a single or double lipid bilayer membrane and occurring within the cell. Includes the nucleus, mitochondria, plastids, vacuoles, and vesicles. Excludes the plasma membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005759	mitochondrial matrix	The gel-like material, with considerable fine structure, that lies in the matrix space, or lumen, of a mitochondrion. It contains the enzymes of the tricarboxylic acid cycle and, in some organisms, the enzymes concerned with fatty acid oxidation.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005777	peroxisome	A small organelle enclosed by a single membrane, and found in most eukaryotic cells. Contains peroxidases and other enzymes involved in a variety of metabolic processes including free radical detoxification, lipid catabolism and biosynthesis, and hydrogen peroxide metabolism.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		GSH	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
		Leu A:183 - Pro A:184	[ RasMol ]
		Leu B:183 - Pro B:184	[ RasMol ]
		Leu C:183 - Pro C:184	[ RasMol ]
		Leu D:183 - Pro D:184	[ RasMol ]

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1r4w
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	GSTK1_RAT \| P24473
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.5.1.18
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	GSTK1_RAT \| P24473
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1R4W)

(no "Related Entries Specified in the PDB File" available for 1R4W)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (8, 32)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 4)

CATH Domains (0, 0)

Pfam Domains (1, 4)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File