Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF THE OMPA-LIKE DOMAIN OF RMPM FROM NEISSERIA MENINGITIDIS
 
Authors :  S. Grizot, S. K. Buchanan
Date :  24 Sep 03  (Deposition) - 11 May 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A
Keywords :  Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  S. Grizot, S. K. Buchanan
Structure Of The Ompa-Like Domain Of Rmpm From Neisseria Meningitidis
Mol. Microbiol. V. 51 1027 2004
PubMed-ID: 14763978  |  Reference-DOI: 10.1111/J.1365-2958.2003.03903.X
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - OUTER MEMBRANE PROTEIN CLASS 4
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-20B
    Expression System StrainORIGAMI(DE3)
    Expression System Taxid562
    Expression System Vector TypePLASMID
    FragmentC-TERMINAL DOMAIN
    GeneRMPM
    Organism ScientificNEISSERIA MENINGITIDIS
    Organism Taxid487

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

Asymmetric/Biological Unit (1, 1)
No.NameCountTypeFull Name
1TRS1Ligand/Ion2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL

(-) Sites  (1, 1)

Asymmetric Unit (1, 1)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:137 , ASN A:141 , HOH A:340 , HOH A:341BINDING SITE FOR RESIDUE TRS A 229

(-) SS Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1A:169 -A:192

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1R1M)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (1, 1)

Asymmetric/Biological Unit (1, 1)
  dbSNPPDB
No.SourceVariant IDVariantUniProt IDStatusIDChainVariant
1UniProtVAR_OMP4_NEIMB_001 *V132IOMP4_NEIMB  ---  ---AI110I
   * ID not provided by source

  SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1OMPA_2PS51123 OmpA-like domain profile.OMP4_NEIMA92-229  1A:70-207
OMP4_NEIMB92-229  1A:70-207
2OMPA_1PS01068 OmpA-like domain.OMP4_NEIMA137-181  1A:115-159
OMP4_NEIMB137-181  1A:115-159

(-) Exons   (0, 0)

(no "Exon" information available for 1R1M)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:140
 aligned with OMP4_NEIMA | P0A0V2 from UniProtKB/Swiss-Prot  Length:242

    Alignment length:140
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229
           OMP4_NEIMA    90 PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLGQTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV 229
               SCOP domains d1r1ma_ A: Outer membrane protein class 4, RmpM, C-terminal domain                                                                           SCOP domains
               CATH domains 1r1mA00 A:68-207 OmpA-like                                                                                                                   CATH domains
               Pfam domains --------------OmpA-1r1mA01 A:82-175                                                                         -------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeehhhhhh......hhhhhhhhhhhhhhhh...eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeee.......hhhhhhhhhhh.......hhhhhhhhhhhhhh.eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------I------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (1) --OMPA_2  PDB: A:70-207 UniProt: 92-229                                                                                                      PROSITE (1)
                PROSITE (2) -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (2)
                PROSITE (3) -------------------------------------------------------------------------------------------------------------------------------------------- PROSITE (3)
                PROSITE (4) -----------------------------------------------OMPA_1  PDB: A:115-159 UniProt: 137-181      ------------------------------------------------ PROSITE (4)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1r1m A  68 PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV 207
                                    77        87        97       107       117       127       137       147       157       167       177       187       197       207

Chain A from PDB  Type:PROTEIN  Length:140
 aligned with OMP4_NEIMB | P0A0V3 from UniProtKB/Swiss-Prot  Length:242

    Alignment length:140
                                    99       109       119       129       139       149       159       169       179       189       199       209       219       229
           OMP4_NEIMB    90 PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNVQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV 229
               SCOP domains d1r1ma_ A: Outer membrane protein class 4, RmpM, C-terminal domain                                                                           SCOP domains
               CATH domains 1r1mA00 A:68-207 OmpA-like                                                                                                                   CATH domains
               Pfam domains --------------OmpA-1r1mA01 A:82-175                                                                         -------------------------------- Pfam domains
         Sec.struct. author ..eeeeeeeeehhhhhh......hhhhhhhhhhhhhhhh...eeeeeeeee.....hhhhhhhhhhhhhhhhhhhhhhh..hhh.eeeee.......hhhhhhhhhhh.......hhhhhhhhhhhhhh.eeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------I------------------------------------------------------------------------------------------------- SAPs(SNPs)
                PROSITE (2) --OMPA_2  PDB: A:70-207 UniProt: 92-229                                                                                                      PROSITE (2)
                PROSITE (3) -----------------------------------------------OMPA_1  PDB: A:115-159 UniProt: 137-181      ------------------------------------------------ PROSITE (3)
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1r1m A  68 PQYVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQALSERRAYVVANNLVSNGVPVSRISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREALIACIEPDRRVDVKIRSIV 207
                                    77        87        97       107       117       127       137       147       157       167       177       187       197       207

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

Asymmetric/Biological Unit

(-) CATH Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (8, 16)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (OMP4_NEIMB | P0A0V3)
molecular function
    GO:0015288    porin activity    Catalysis of the transfer of substances, sized less than 1000 Da, from one side of the membrane to the other. The transmembrane portions of porins consist exclusively of beta-strands which form a beta-barrel. They are found in the outer membranes of Gram-negative bacteria, mitochondria, plastids and possibly acid-fast Gram-positive bacteria.
biological process
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0046930    pore complex    Any small opening in a membrane that allows the passage of gases and/or liquids.

Chain A   (OMP4_NEIMA | P0A0V2)
molecular function
    GO:0015288    porin activity    Catalysis of the transfer of substances, sized less than 1000 Da, from one side of the membrane to the other. The transmembrane portions of porins consist exclusively of beta-strands which form a beta-barrel. They are found in the outer membranes of Gram-negative bacteria, mitochondria, plastids and possibly acid-fast Gram-positive bacteria.
biological process
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0055085    transmembrane transport    The process in which a solute is transported across a lipid bilayer, from one side of a membrane to the other
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0009279    cell outer membrane    A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0046930    pore complex    Any small opening in a membrane that allows the passage of gases and/or liquids.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    TRS  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1r1m)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1r1m
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  OMP4_NEIMA | P0A0V2
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  OMP4_NEIMB | P0A0V3
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  OMP4_NEIMA | P0A0V2
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  OMP4_NEIMB | P0A0V3
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1R1M)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1R1M)