|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
NMR Structure (1, 1)
|
Sites (1, 1)
NMR Structure (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 1QYP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 1QYP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 1QYP) |
PROSITE Motifs (2, 2)
NMR Structure (2, 2)
|
||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 1QYP) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:57 aligned with TFS_THECE | Q56254 from UniProtKB/Swiss-Prot Length:110 Alignment length:85 35 45 55 65 75 85 95 105 TFS_THECE 26 GYEEPFDEEKDREKTVIKQEVKHKPDEGIVVIEQDLKTLPTTKITCPKCGNDTAYWWEMQTRAGDEPSTIFYKCTKCGHTWRSYE 110 SCOP domains d 1q ypa_ A: RBP9 subunit of RNA polymerase II SCOP domains CATH domains 1 qy pA00 A:1-57 [code=2.20.25.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains
|
||||||||||||||||||||
SCOP Domains (1, 1)| NMR Structure |
CATH Domains (1, 1)
NMR Structure
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 1QYP) |
Gene Ontology (6, 6)|
NMR Structure(hide GO term definitions) Chain A (TFS_THECE | Q56254)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|