1QU1 - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF EHA2 (23-185)

Authors :   J. Chen, J. J. Skehel, D. C. Wiley

Date :   05 Jul 99 (Deposition) - 05 Jan 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,C  (1x)
Biol. Unit 2: D,E,F  (1x)

Keywords :   Hemagglutinin, Low-Ph, Virus/Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   J. Chen, J. J. Skehel, D. C. Wiley
N- And C-Terminal Residues Combine In The Fusion-Ph Influenza Hemagglutinin Ha(2) Subunit To Form An N Cap That Terminates The Triple-Stranded Coiled Coil.
Proc. Natl. Acad. Sci. Usa V. 96 8967 1999
PubMed-ID: 10430879 | Reference-DOI: 10.1073/PNAS.96.16.8967
(for further references see the PDB file header)

Molecule 1 - PROTEIN (INFLUENZA RECOMBINANT HA2 CHAIN)
	Chains	:	A, B, C, D, E, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Taxid	:	562
	Organism Scientific	:	INFLUENZA A VIRUS
	Organism Taxid	:	11320

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B	C
Biological Unit 2 (1x)	:				D	E	F

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1QU1)

(no "Site" information available for 1QU1)

Asymmetric Unit

No.	Residues
1	A:144	-	A:148
2	B:144	-	B:148
3	C:144	-	C:148
4	D:144	-	D:148
5	E:144	-	E:148
6	F:144	-	F:148

(no "Cis Peptide Bond" information available for 1QU1)

(no "SAP(SNP)/Variant" information available for 1QU1)

(no "PROSITE Motif" information available for 1QU1)

(no "Exon" information available for 1QU1)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:133
 aligned with HEMA_I68A0 | P03437 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:142
                                   388       398       408       418       428       438       448       458       468       478       488       498       508       518  
           HEMA_I68A0   379 QAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG 520
               SCOP domains d1qu1a_ A: Influenza hemagglutinin (stalk)                                                                                                     SCOP domains
               CATH domains 1qu1A00 A:34-175  [code=3.90.20.10, no name defined]                                                                                           CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh---------.........hhhhhhhhhhh.................... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qu1 A  34 QAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQL---------GSFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKG 175
                                    43        53        63        73        83        93       103       113       123  |      -  |    143       153       163       173  
                                                                                                                      126       136

Chain B from PDB  Type:PROTEIN  Length:144
 aligned with HEMA_I68A0 | P03437 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:144
                                   387       397       407       417       427       437       447       457       467       477       487       497       507       517    
           HEMA_I68A0   378 GQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGV 521
               SCOP domains d1qu1b_ B: Influenza hemagglutinin (stalk)                                                                                                       SCOP domains
               CATH domains 1qu1B00 B:33-176  [code=3.90.20.10, no name defined]                                                                                             CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhheeeee..eeee......hhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qu1 B  33 GQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGSFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGV 176
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172

Chain C from PDB  Type:PROTEIN  Length:150
 aligned with HEMA_I68A0 | P03437 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:150
                                   390       400       410       420       430       440       450       460       470       480       490       500       510       520       530
           HEMA_I68A0   381 ADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDW 530
               SCOP domains d1qu1c_ C: Influenza hemagglutinin (stalk)                                                                                                             SCOP domains
               CATH domains 1qu1C00 C:36-185  [code=3.90.20.10, no name defined]                                                                                                   CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh...............hhhhhhhhhhh.............................. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qu1 C  36 ADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGSFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDW 185
                                    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185

Chain D from PDB  Type:PROTEIN  Length:146
 aligned with HEMA_I68A0 | P03437 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:146
                                   387       397       407       417       427       437       447       457       467       477       487       497       507       517      
           HEMA_I68A0   378 GQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVEL 523
               SCOP domains d1qu1d_ D: Influenza hemagglutinin (stalk)                                                                                                         SCOP domains
               CATH domains 1qu1D00 D:33-178  [code=3.90.20.10, no name defined]                                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eehhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhh..hhhhhhhh........hhhhhhhhhhh...................ee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qu1 D  33 GQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGSFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVEL 178
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172

Chain E from PDB  Type:PROTEIN  Length:146
 aligned with HEMA_I68A0 | P03437 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:146
                                   387       397       407       417       427       437       447       457       467       477       487       497       507       517      
           HEMA_I68A0   378 GQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVEL 523
               SCOP domains d1qu1e_ E: Influenza hemagglutinin (stalk)                                                                                                         SCOP domains
               CATH domains 1qu1E00 E:33-178  [code=3.90.20.10, no name defined]                                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhhh...............hhhhhhhh........................ Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qu1 E  33 GQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGSFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVEL 178
                                    42        52        62        72        82        92       102       112       122       132       142       152       162       172

Chain F from PDB  Type:PROTEIN  Length:155
 aligned with HEMA_I68A0 | P03437 from UniProtKB/Swiss-Prot  Length:566

    Alignment length:155
                                   385       395       405       415       425       435       445       455       465       475       485       495       505       515       525     
           HEMA_I68A0   376 GTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGCFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDW 530
               SCOP domains d1qu1f_ F: Influenza hemagglutinin (stalk)                                                                                                                  SCOP domains
               CATH domains 1qu1F00 F:31-185  [code=3.90.20.10, no name defined]                                                                                                        CATH domains
           Pfam domains (1) Hemagglutinin-1qu1F01 F:31-185                                                                                                                              Pfam domains (1)
           Pfam domains (2) Hemagglutinin-1qu1F02 F:31-185                                                                                                                              Pfam domains (2)
           Pfam domains (3) Hemagglutinin-1qu1F03 F:31-185                                                                                                                              Pfam domains (3)
           Pfam domains (4) Hemagglutinin-1qu1F04 F:31-185                                                                                                                              Pfam domains (4)
           Pfam domains (5) Hemagglutinin-1qu1F05 F:31-185                                                                                                                              Pfam domains (5)
           Pfam domains (6) Hemagglutinin-1qu1F06 F:31-185                                                                                                                              Pfam domains (6)
         Sec.struct. author ......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhh.............................. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qu1 F  31 GTGQAADLKSTQAAIDQINGKLNRVIEKTNEKFHQIEKEFSEVEGRIQDLEKYVEDTKIDLWSYNAELLVALENQHTIDLTDSEMNKLFEKTRRQLRENAEEMGNGSFKIYHKCDNACIESIRNGTYDHDVYRDEALNNRFQIKGVELKSGYKDW 185
                                    40        50        60        70        80        90       100       110       120       130       140       150       160       170       180

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Coiled coil proteins (689)

Fold: Stalk segment of viral fusion proteins (231)

Superfamily: Influenza hemagglutinin (stalk) (172)

Family: Influenza hemagglutinin (stalk) (161)

Protein domain: Influenza hemagglutinin (stalk) (102)

Influenza A virus, different strains [TaxId: 11320] (93)

1a	d1qu1a_	A:
1b	d1qu1c_	C:
1c	d1qu1d_	D:
1d	d1qu1e_	E:
1e	d1qu1f_	F:
1f	d1qu1b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Hemagglutinin Ectodomain; Chain B (70)

Homologous Superfamily: [code=3.90.20.10, no name defined] (69)

Influenza a virus. Organism_taxid: 11320. (1)

1a	1qu1F00	F:31-185
1b	1qu1C00	C:36-185
1c	1qu1D00	D:33-178
1d	1qu1E00	E:33-178
1e	1qu1B00	B:33-176
1f	1qu1A00	A:34-175

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: Hemagglutinin] (58)

Family: Hemagglutinin (58)

Influenza A virus (strain A/Aichi/2/1968 H3N2) (6)

1a	Hemagglutinin-1qu1F01	F:31-185
1b	Hemagglutinin-1qu1F02	F:31-185
1c	Hemagglutinin-1qu1F03	F:31-185
1d	Hemagglutinin-1qu1F04	F:31-185
1e	Hemagglutinin-1qu1F05	F:31-185
1f	Hemagglutinin-1qu1F06	F:31-185

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (HEMA_I68A0 | P03437)

molecular function
	GO:0046789	host cell surface receptor binding	Interacting selectively and non-covalently with a receptor on the host cell surface.
biological process
	GO:0075512	clathrin-dependent endocytosis of virus by host cell	Any clathrin-mediated endocytosis that is involved in the uptake of a virus into a host cell. Begins by invagination of a specific region of the host cell plasma membrane around the bound virus to form a clathrin-coated pit, which then pinches off to form a clathrin-coated endocytic vesicle containing the virus.
	GO:0075509	endocytosis involved in viral entry into host cell	Any endocytosis that is involved in the uptake of a virus into a host cell.
	GO:0039654	fusion of virus membrane with host endosome membrane	Fusion of a virus membrane with a host endosome membrane. Occurs after internalization of the virus through the endosomal pathway, and results in release of the virus contents into the cell.
	GO:0019064	fusion of virus membrane with host plasma membrane	Fusion of a viral membrane with the host cell membrane during viral entry. Results in release of the virion contents into the cytoplasm.
	GO:0039663	membrane fusion involved in viral entry into host cell	Merging of the virion membrane and a host membrane (host plasma membrane or host organelle membrane) that is involved in the uptake of a virus into a host cell.
	GO:0019065	receptor-mediated endocytosis of virus by host cell	Any receptor-mediated endocytosis that is involved in the uptake of a virus into a host cell; successive instances of virus endocytosis result in the accumulation of virus particles within the cell.
	GO:0046718	viral entry into host cell	The process that occurs after viral attachment by which a virus, or viral nucleic acid, breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the viral nucleic acid is released into the host cell cytoplasm.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
	GO:0019062	virion attachment to host cell	The process by which a virion protein binds to molecules on the host cellular surface or host cell surface projection.
cellular component
	GO:0033644	host cell membrane	Double layer of lipid molecules as it encloses host cells, and, in eukaryotes, many organelles; may be a single or double lipid bilayer; also includes associated proteins. The host is defined as the larger of the organisms involved in a symbiotic interaction.
	GO:0020002	host cell plasma membrane	The plasma membrane surrounding a host cell.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0019031	viral envelope	The lipid bilayer of a virion that surrounds the protein capsid. May also contain glycoproteins.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.
	GO:0055036	virion membrane	The lipid bilayer surrounding a virion.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qu1)

	Sites
(no "Sites" information available for 1qu1)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qu1)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qu1
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	HEMA_I68A0 \| P03437
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	HEMA_I68A0 \| P03437
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Related Entries Specified in the PDB File" available for 1QU1)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (6, 6)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (1, 6)

Pfam Domains (1, 6)

Gene Ontology (17, 17)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File