1QSD - JenaLib

Asym./Biol. Unit (Jmol Viewer)

Title :   RBL2P, BETA-TUBULIN BINDING POST-CHAPERONIN COFACTOR

Authors :   S. Steinbacher

Date :   21 Jun 99 (Deposition) - 22 Dec 99 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.20

Chains :   Asym./Biol. Unit : A,B

Keywords :   Four-Helix-Bundle, Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   S. Steinbacher
Crystal Structure Of The Post-Chaperonin Beta-Tubulin Binding Cofactor Rbl2P
Nat. Struct. Biol. V. 6 1029 1999
PubMed-ID: 10542094 | Reference-DOI: 10.1038/14912
(for further references see the PDB file header)

Molecule 1 - PROTEIN (BETA-TUBULIN BINDING POST-CHAPERONIN COFACTOR)
	Chains	:	A, B
	Fragment	:	RBL2P
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Other Details	:	ORIGINAL SEQUENCE

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1QSD)

(no "Site" information available for 1QSD)

(no "SS Bond" information available for 1QSD)

(no "Cis Peptide Bond" information available for 1QSD)

(no "SAP(SNP)/Variant" information available for 1QSD)

(no "PROSITE Motif" information available for 1QSD)

Asymmetric/Biological Unit (1, 2)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	YOR265W	1	YOR265W.1	XV:820453-820773	321	TBCA_YEAST	1-106	106	2	A:4-105 B:4-105	102 102

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:102
 aligned with TBCA_YEAST | P48606 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:102
                                    13        23        33        43        53        63        73        83        93       103  
           TBCA_YEAST     4 TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS 105
               SCOP domains d1qsda_ A: Tubulin chaperone cofactor A                                                                SCOP domains
               CATH domains 1qsdA00 A:4-105  [code=1.20.58.90, no name defined]                                                    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: A:4-105 UniProt: 1-106 [INCOMPLETE]                                                     Transcript 1
                 1qsd A   4 TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS 105
                                    13        23        33        43        53        63        73        83        93       103

Chain B from PDB  Type:PROTEIN  Length:102
 aligned with TBCA_YEAST | P48606 from UniProtKB/Swiss-Prot  Length:106

    Alignment length:102
                                    13        23        33        43        53        63        73        83        93       103  
           TBCA_YEAST     4 TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS 105
               SCOP domains d1qsdb_ B: Tubulin chaperone cofactor A                                                                SCOP domains
               CATH domains 1qsdB00 B:4-105  [code=1.20.58.90, no name defined]                                                    CATH domains
           Pfam domains (1) -TBCA-1qsdB01 B:5-95                                                                        ---------- Pfam domains (1)
           Pfam domains (2) -TBCA-1qsdB02 B:5-95                                                                        ---------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------ PROSITE
               Transcript 1 Exon 1.1  PDB: B:4-105 UniProt: 1-106 [INCOMPLETE]                                                     Transcript 1
                 1qsd B   4 TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS 105
                                    13        23        33        43        53        63        73        83        93       103

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All alpha proteins (14657)

Fold: Spectrin repeat-like (186)

Superfamily: Tubulin chaperone cofactor A (2)

Family: Tubulin chaperone cofactor A (2)

Protein domain: Tubulin chaperone cofactor A (2)

Baker's yeast (Saccharomyces cerevisiae), Rbl2p [TaxId: 4932] (1)

1a	d1qsda_	A:
1b	d1qsdb_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Mainly Alpha (13335)

Architecture: Up-down Bundle (3216)

Topology: Methane Monooxygenase Hydroxylase; Chain G, domain 1 (192)

Homologous Superfamily: [code=1.20.58.90, no name defined] (8)

Baker's yeast (Saccharomyces cerevisiae) (1)

1a	1qsdA00	A:4-105
1b	1qsdB00	B:4-105

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: TBCA] (2)

Family: TBCA (2)

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) (1)

1a	TBCA-1qsdB01	B:5-95
1b	TBCA-1qsdB02	B:5-95

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (TBCA_YEAST | P48606)

molecular function
	GO:0048487	beta-tubulin binding	Interacting selectively and non-covalently with the microtubule constituent protein beta-tubulin.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0015631	tubulin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of tubulin, including microtubules.
biological process
	GO:0007023	post-chaperonin tubulin folding pathway	Completion of folding of alpha- and beta-tubulin; takes place subsequent to chaperonin-mediated partial folding; mediated by a complex of folding cofactors.
	GO:0007021	tubulin complex assembly	The aggregation and bonding together of alpha- and beta-tubulin to form a tubulin heterodimer.
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005856	cytoskeleton	Any of the various filamentous elements that form the internal framework of cells, and typically remain after treatment of the cells with mild detergent to remove membrane constituents and soluble components of the cytoplasm. The term embraces intermediate filaments, microfilaments, microtubules, the microtrabecular lattice, and other structures characterized by a polymeric filamentous nature and long-range order within the cell. The various elements of the cytoskeleton not only serve in the maintenance of cellular shape but also have roles in other cellular functions, including cellular movement, cell division, endocytosis, and movement of organelles.
	GO:0005874	microtubule	Any of the long, generally straight, hollow tubes of internal diameter 12-15 nm and external diameter 24 nm found in a wide variety of eukaryotic cells; each consists (usually) of 13 protofilaments of polymeric tubulin, staggered in such a manner that the tubulin monomers are arranged in a helical pattern on the microtubular surface, and with the alpha/beta axes of the tubulin subunits parallel to the long axis of the tubule; exist in equilibrium with pool of tubulin monomers and can be rapidly assembled or disassembled in response to physiological stimuli; concerned with force generation, e.g. in the spindle.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qsd)

	Sites
(no "Sites" information available for 1qsd)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qsd)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qsd
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	TBCA_YEAST \| P48606
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	TBCA_YEAST \| P48606
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1QSD)

(no "Related Entries Specified in the PDB File" available for 1QSD)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (0, 0)

Exons (1, 2)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (8, 8)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File