1QOU - JenaLib

Asym./Biol. Unit - manually (Jmol Viewer)

Asym./Biol. Unit (Jmol Viewer)

Title :   CEN (CENTRORADIALIS) PROTEIN FROM ANTIRRHINUM

Authors :   M. J. Banfield, R. L. Brady

Date :   17 Nov 99 (Deposition) - 31 Mar 00 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.90

Chains :   Asym./Biol. Unit : A,B

Keywords :   Plant Protein, Influorescence Determination In Flowering Plant Meristem, Signalling, Member Of The Phosphatidylethanolamine Binding Protein Family (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   M. J. Banfield, R. L. Brady
The Structure Of Antirrhinum Centroradialis Protein (Cen) Suggests A Role As A Kinase Regulator
J. Mol. Biol. V. 297 1161 2000
PubMed-ID: 10764580 | Reference-DOI: 10.1006/JMBI.2000.3619
(for further references see the PDB file header)

Molecule 1 - CEN
	Cellular Location	:	CYTOPLASM
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Cellular Location	:	CYTOPLASM
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Organism Common	:	GARDEN SNAPDRAGON
	Organism Scientific	:	ANTIRRHINUM MAJUS
	Organism Taxid	:	4151
	Other Details	:	INTER-MOLECULAR DISULPHIDE BOND FORMED IN THE CRYSTAL, BETWEEN RESIDUES A145 AND B145.

		1	2
Asymmetric/Biological Unit	:	A	B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1QOU)

(no "Site" information available for 1QOU)

Asymmetric/Biological Unit

No.	Residues
1	A:145	-	B:145

Asymmetric/Biological Unit

No.	Residues
1	Val A:73	-	Pro A:74
2	Arg A:82	-	Glu A:83
3	Val B:73	-	Pro B:74
4	Arg B:82	-	Glu B:83

Asymmetric/Biological Unit (3, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CEN_ANTMA_001 *	V	5	I	CEN_ANTMA	---	---	B	V	1	I
2	UniProt	VAR_CEN_ANTMA_002 *	K	28	Q	CEN_ANTMA	---	---	A/B	K	24	Q
3	UniProt	VAR_CEN_ANTMA_003 *	S	35	A	CEN_ANTMA	---	---	B	S	31	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric/Biological Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PBP	PS01220	Phosphatidylethanolamine-binding protein family signature.	CEN_ANTMA	70-92	2	A:64-86 B:64-86

(no "Exon" information available for 1QOU)

Asymmetric/Biological Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:154
 aligned with CEN_ANTMA | Q41261 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:164
                                    22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172    
           CEN_ANTMA     13 GRVIGDVVDHFTSTVKMSVIYNSNNSIKHVYNGHELFPSAVTSTPRVEVHGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFVFLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRET  176
               SCOP domains d1qoua_ A: Centroradia   lis protein Cen                                                                                                                             SCOP domains
               CATH domains 1qouA00 A:9-175 Phosph   atidylethanolamine-binding Protein;                                                                                                         CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ................eeee..---...........hhhhh....eeee........eeeeeee.............eeeeeee.......hhhheeee...........eeeeeeeee.....-------.......hhhhhhhhh......eeeeeee.... Sec.struct. author
                 SAPs(SNPs) ---------------Q---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------PBP  PDB: A:64-86      ------------------------------------------------------------------------------------ PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qou A    9 GRVIGDVVDHFTSTVKMSVIYN---SIKHVYNGHELFPSAVTSTPRVEVHGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFVFLLFKQKKRG-------VVCRDGFNTRKFTQENELGLPVAAVFFNCQRET  175
                                    18        28 |   || 35        45    ||  56        66        76        86        95       105      |117       127  ||     - |     151       161       171    
                                                30 32B|                50|                                        94A               112|           129A|     143                                
                                                    32C                 52                                                           115             130

Chain B from PDB  Type:PROTEIN  Length:161
 aligned with CEN_ANTMA | Q41261 from UniProtKB/Swiss-Prot  Length:181

    Alignment length:171
                                    14        24        34        44        54        64        74        84        94       104       114       124       134       144       154       164       174 
           CEN_ANTMA      5 VSSDPLVIGRVIGDVVDHFTSTVKMSVIYNSNNSIKHVYNGHELFPSAVTSTPRVEVHGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFVFLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRE  175
               SCOP domains d1qoub_ B: Centroradialis prote  in Cen                                                                                                                                     SCOP domains
               CATH domains 1qouB00 B:1-174 Phosphatidyleth  anolamine-binding Protein;                                                                                                                 CATH domains
           Pfam domains (1) ---------------------PBP-1qouB0  1 B:22-170                                                                                                                            ---- Pfam domains (1)
           Pfam domains (2) ---------------------PBP-1qouB0  2 B:22-170                                                                                                                            ---- Pfam domains (2)
         Sec.struct. author ...hhhhhhhhhhhh.........eeee...--...........hhhhh....eeee........eeeeeee.............eeeeeee.......hhhheeee...........eeeeeeeee....--------.......hhhhhhhhh......eeeeeee... Sec.struct. author
                 SAPs(SNPs) I----------------------Q------A-------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------PBP  PDB: B:64-86      ----------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                1qou B    1 VSSDPLVIGRVIGDVVDHFTSTVKMSVIYNS--SIKHVYNGHELFPSAVTSTPRVEVHGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFVFLLFKQKKR--------VVCRDGFNTRKFTQENELGLPVAAVFFNCQRE  174
                                    10        20        30|  ||   37        47  ||    58        68        78        88      | 97       107    || 119       129|      143       153       163       173 
                                                         31  ||                50|                                        94A               112|           129A      143                               
                                                           32B|                 52                                                           115                                                       
                                                            32C

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric/Biological Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: All beta proteins (24004)

Fold: PEBP-like (18)

Superfamily: PEBP-like (18)

Family: Phosphatidylethanolamine binding protein (12)

Protein domain: Centroradialis protein Cen (1)

Garden snapdragon (Antirrhinum majus) [TaxId: 4151] (1)

1a	d1qoua_	A:
1b	d1qoub_	B:

Asymmetric/Biological Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: Alpha-Beta Complex (3881)

Topology: Phosphatidylethanolamine-binding Protein (16)

Homologous Superfamily: Phosphatidylethanolamine-binding Protein; (16)

Garden snapdragon (Antirrhinum majus) (1)

1a	1qouB00	B:1-174
1b	1qouA00	A:9-175

Asymmetric/Biological Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: PBP] (9)

Family: PBP (9)

Antirrhinum majus (Garden snapdragon) (1)

1a	PBP-1qouB01	B:22-170
1b	PBP-1qouB02	B:22-170

Asymmetric/Biological Unit(hide GO term definitions)

Chain A,B (CEN_ANTMA | Q41261)

biological process
	GO:0030154	cell differentiation	The process in which relatively unspecialized cells, e.g. embryonic or regenerative cells, acquire specialized structural and/or functional features that characterize the cells, tissues, or organs of the mature organism or some other relatively stable phase of the organism's life history. Differentiation includes the processes involved in commitment of a cell to a specific fate and its subsequent development to the mature state.
	GO:0009908	flower development	The process whose specific outcome is the progression of the flower over time, from its formation to the mature structure. The flower is the reproductive structure in a plant, and its development begins with the transition of the vegetative or inflorescence meristem into a floral meristem.
	GO:0007275	multicellular organism development	The biological process whose specific outcome is the progression of a multicellular organism over time from an initial condition (e.g. a zygote or a young adult) to a later condition (e.g. a multicellular animal or an aged adult).
cellular component
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

Asymmetric/Biological Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qou)

	Sites
(no "Sites" information available for 1qou)

	Cis Peptide Bonds
		Arg A:82 - Glu A:83	[ RasMol ]
		Arg B:82 - Glu B:83	[ RasMol ]
		Val A:73 - Pro A:74	[ RasMol ]
		Val B:73 - Pro B:74	[ RasMol ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qou
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CEN_ANTMA \| Q41261
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CEN_ANTMA \| Q41261
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 1QOU)

(no "Related Entries Specified in the PDB File" available for 1QOU)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (4, 4)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (3, 4)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (4, 4)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File