Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CYTOCHROME CH FROM METHYLOBACTERIUM EXTORQUENS
 
Authors :  J. Read, R. Gill, S. L. Dales, J. B. Cooper, S. P. Wood, C. Anthony
Date :  13 Oct 99  (Deposition) - 13 Oct 00  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.01
Chains :  Asym. Unit :  A,B,C
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Keywords :  Cytochrome, Cytochrome C, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Read, R. Gill, S. L. Dales, J. B. Cooper, S. P. Wood, C. Anthony
The Molecular Structure Of An Unusual Cytochrome C2 Determined At 2. 0A; The Cytochrome Ch From Methylobacterium Extorquens
Protein Sci. V. 8 1232 1999
PubMed-ID: 10386873

(-) Compounds

Molecule 1 - CYTOCHROME CH
    Chains: A, B, C
    Organism Scientific: METHYLOBACTERIUM EXTORQUENS
    Organism Taxid: 408

 Structural Features

(-) Chains, Units

  123
Asymmetric Unit : ABC
Biological Unit 1 (1x): A  
Biological Unit 2 (1x):  B 
Biological Unit 3 (1x):   C

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

Asymmetric Unit (1, 3)
No.NameCountTypeFull Name
1HEC3Ligand/IonHEME C
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1HEC1Ligand/IonHEME C
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1HEC1Ligand/IonHEME C
Biological Unit 3 (1, 1)
No.NameCountTypeFull Name
1HEC1Ligand/IonHEME C

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWARECYS A:14 , CYS A:17 , HIS A:18 , PRO A:27 , ALA A:37 , GLY A:38 , TYR A:44 , PHE A:46 , SER A:47 , TRP A:57 , TRP A:65 , LEU A:66 , THR A:76 , LYS A:77 , MET A:78 , VAL A:79 , PHE A:80 , HOH A:2013 , HOH A:2052BINDING SITE FOR RESIDUE HEC A 101
2AC2SOFTWAREPRO B:13 , CYS B:14 , CYS B:17 , HIS B:18 , PRO B:27 , ALA B:37 , GLY B:38 , TYR B:44 , PHE B:46 , SER B:47 , LEU B:50 , TRP B:57 , TRP B:65 , LEU B:66 , THR B:76 , LYS B:77 , MET B:78 , VAL B:79 , PHE B:80 , HOH B:2064BINDING SITE FOR RESIDUE HEC B 101
3AC3SOFTWAREPRO C:13 , CYS C:14 , CYS C:17 , HIS C:18 , VAL C:25 , PRO C:27 , LEU C:29 , ALA C:37 , GLY C:38 , TYR C:44 , PHE C:46 , SER C:47 , LEU C:50 , TRP C:57 , TRP C:65 , LEU C:66 , THR C:76 , LYS C:77 , MET C:78 , VAL C:79 , PHE C:80 , ILE C:83 , HOH C:2018 , HOH C:2060BINDING SITE FOR RESIDUE HEC C 101

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QN2)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QN2)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1QN2)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QN2)

(-) Exons   (0, 0)

(no "Exon" information available for 1QN2)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:99
 aligned with Q7SIA4_METEX | Q7SIA4 from UniProtKB/TrEMBL  Length:100

    Alignment length:99
                                    10        20        30        40        50        60        70        80        90         
          Q7SIA4_METEX    1 EGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK 99
               SCOP domains d1qn2a_ A: Cytochrome ch                                                                            SCOP domains
               CATH domains 1qn2A00 A:1-99 Cytochrome c                                                                         CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhh.............................hhhhhhhh...hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                  1qn2 A  1 EGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK 99
                                    10        20        30        40        50        60        70        80        90         


Chain B from PDB  Type:PROTEIN  Length:98
 aligned with Q7SIA4_METEX | Q7SIA4 from UniProtKB/TrEMBL  Length:100

    Alignment length:98
                                    11        21        31        41        51        61        71        81        91        
          Q7SIA4_METEX    2 GDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK 99
               SCOP domains d1qn2b_ B: Cytochrome ch                                                                           SCOP domains
               CATH domains 1qn2B00 B:2-99 Cytochrome c                                                                        CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhh.......................hhhhh..hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                  1qn2 B  2 GDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK 99
                                    11        21        31        41        51        61        71        81        91        


Chain C from PDB  Type:PROTEIN  Length:98
 aligned with Q7SIA4_METEX | Q7SIA4 from UniProtKB/TrEMBL  Length:100

    Alignment length:98
                                    11        21        31        41        51        61        71        81        91        
          Q7SIA4_METEX    2 GDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK 99
               SCOP domains d1qn2c_ C: Cytochrome ch                                                                           SCOP domains
               CATH domains 1qn2C00 C:2-99 Cytochrome c                                                                        CATH domains
           Pfam domains (1) --Cytochrom_C-1qn2C01 C:4-99                                                                       Pfam domains (1)
           Pfam domains (2) --Cytochrom_C-1qn2C02 C:4-99                                                                       Pfam domains (2)
           Pfam domains (3) --Cytochrom_C-1qn2C03 C:4-99                                                                       Pfam domains (3)
         Sec.struct. author .hhhhhhhhhhhhhhh......................hhhhh..hhhhhhh....hhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------- Transcript
                  1qn2 C  2 GDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEGADGYAFSDALKKSGLTWDQADLKQWLADPKKKVPGTKMVFPGISDPKKVDDIIAYLKTK 99
                                    11        21        31        41        51        61        71        81        91
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 3)

Asymmetric Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 3)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 3)

Asymmetric Unit
(-)
Clan: Cytochrome-c (108)

(-) Gene Ontology  (3, 3)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C   (Q7SIA4_METEX | Q7SIA4)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qn2)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qn2
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7SIA4_METEX | Q7SIA4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7SIA4_METEX | Q7SIA4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1QN2)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QN2)