Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF E. COLI ENOYL ACYL CARRIER PROTEIN REDUCTASE IN COMPLEX WITH NAD AND TRICLOSAN
 
Authors :  S. Rowsell, R. A. Pauptit
Date :  20 Apr 99  (Deposition) - 21 Sep 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym./Biol. Unit :  A,B,C,D
Keywords :  Fatty Acid Synthesis, Antibacterial, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  W. H. Ward, G. A. Holdgate, S. Rowsell, E. G. Mclean, R. A. Pauptit, E. Clayton, W. W. Nichols, J. G. Colls, C. A. Minshull, D. A. Jude, A. Mistry, D. Timms, R. Camble, N. J. Hales, C. J. Britton, I. W. Taylor
Kinetic And Structural Characteristics Of The Inhibition Of Enoyl (Acyl Carrier Protein) Reductase By Triclosan.
Biochemistry V. 38 12514 1999
PubMed-ID: 10493822  |  Reference-DOI: 10.1021/BI9907779
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (ENOYL-[ACYL-CARRIER PROTEIN] REDUCTASE)
    Chains: A, B, C, D
    EC Number: 1.3.1.9
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Gene: FABI
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 8)

Asymmetric/Biological Unit (2, 8)
No.NameCountTypeFull Name
1NAD4Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
2TCL4Ligand/IonTRICLOSAN

(-) Sites  (8, 8)

Asymmetric Unit (8, 8)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY A:13 , VAL A:14 , ALA A:15 , SER A:19 , ILE A:20 , GLN A:40 , LEU A:44 , CYS A:63 , ASP A:64 , VAL A:65 , SER A:91 , ILE A:92 , GLY A:93 , LEU A:144 , SER A:145 , LYS A:163 , ALA A:189 , GLY A:190 , PRO A:191 , ILE A:192 , THR A:194 , ALA A:196 , TCL A:601 , HOH A:608 , HOH A:611 , HOH A:617 , HOH A:619 , HOH A:649 , HOH A:662 , HOH A:667BINDING SITE FOR RESIDUE NAD A 501
2AC2SOFTWAREGLY A:93 , ALA A:95 , LEU A:100 , TYR A:146 , TYR A:156 , ALA A:196 , ILE A:200 , NAD A:501BINDING SITE FOR RESIDUE TCL A 601
3AC3SOFTWAREGLY B:13 , VAL B:14 , ALA B:15 , SER B:19 , ILE B:20 , GLN B:40 , LEU B:44 , CYS B:63 , ASP B:64 , VAL B:65 , SER B:91 , ILE B:92 , GLY B:93 , LEU B:144 , SER B:145 , LYS B:163 , ALA B:189 , GLY B:190 , PRO B:191 , ILE B:192 , THR B:194 , ALA B:196 , TCL B:602 , HOH B:612 , HOH B:615 , HOH B:621 , HOH B:623 , HOH B:653 , HOH B:666 , HOH B:671BINDING SITE FOR RESIDUE NAD B 502
4AC4SOFTWAREGLY B:93 , ALA B:95 , LEU B:100 , TYR B:146 , TYR B:156 , ALA B:196 , ILE B:200 , NAD B:502BINDING SITE FOR RESIDUE TCL B 602
5AC5SOFTWAREGLY C:13 , VAL C:14 , ALA C:15 , SER C:19 , ILE C:20 , GLN C:40 , LEU C:44 , CYS C:63 , ASP C:64 , VAL C:65 , SER C:91 , ILE C:92 , GLY C:93 , LEU C:144 , SER C:145 , LYS C:163 , ALA C:189 , GLY C:190 , PRO C:191 , ILE C:192 , THR C:194 , ALA C:196 , TCL C:603 , HOH C:614 , HOH C:617 , HOH C:623 , HOH C:625 , HOH C:655 , HOH C:668 , HOH C:673BINDING SITE FOR RESIDUE NAD C 503
6AC6SOFTWAREGLY C:93 , ALA C:95 , LEU C:100 , TYR C:146 , TYR C:156 , ALA C:196 , ILE C:200 , NAD C:503BINDING SITE FOR RESIDUE TCL C 603
7AC7SOFTWAREGLY D:13 , VAL D:14 , ALA D:15 , SER D:19 , ILE D:20 , GLN D:40 , LEU D:44 , CYS D:63 , ASP D:64 , VAL D:65 , SER D:91 , ILE D:92 , GLY D:93 , LEU D:144 , SER D:145 , LYS D:163 , ALA D:189 , GLY D:190 , PRO D:191 , ILE D:192 , THR D:194 , ALA D:196 , TCL D:604 , HOH D:618 , HOH D:621 , HOH D:627 , HOH D:629 , HOH D:659 , HOH D:672 , HOH D:677BINDING SITE FOR RESIDUE NAD D 504
8AC8SOFTWAREGLY D:93 , ALA D:95 , LEU D:100 , TYR D:146 , TYR D:156 , ALA D:196 , ILE D:200 , NAD D:504BINDING SITE FOR RESIDUE TCL D 604

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QG6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1QG6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1QG6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QG6)

(-) Exons   (0, 0)

(no "Exon" information available for 1QG6)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECO57 | P0AEK5 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECO57     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6a_ A: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6A00 A:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 A   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain A from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECOLI | P0AEK4 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECOLI     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6a_ A: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6A00 A:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 A   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain A from PDB  Type:PROTEIN  Length:257
 aligned with FABI_SHIFL | P0AEK6 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_SHIFL     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6a_ A: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6A00 A:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 A   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain B from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECO57 | P0AEK5 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECO57     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6b_ B: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6B00 B:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 B   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain B from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECOLI | P0AEK4 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECOLI     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6b_ B: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6B00 B:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 B   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain B from PDB  Type:PROTEIN  Length:257
 aligned with FABI_SHIFL | P0AEK6 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_SHIFL     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6b_ B: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6B00 B:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 B   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain C from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECO57 | P0AEK5 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECO57     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6c_ C: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6C00 C:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 C   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain C from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECOLI | P0AEK4 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECOLI     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6c_ C: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6C00 C:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 C   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain C from PDB  Type:PROTEIN  Length:257
 aligned with FABI_SHIFL | P0AEK6 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_SHIFL     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6c_ C: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6C00 C:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 C   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain D from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECO57 | P0AEK5 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECO57     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6d_ D: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6D00 D:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
           Pfam domains (1) -----------adh_short_C2-1qg6D01 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (1)
           Pfam domains (2) -----------adh_short_C2-1qg6D02 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (2)
           Pfam domains (3) -----------adh_short_C2-1qg6D03 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (3)
           Pfam domains (4) -----------adh_short_C2-1qg6D04 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (4)
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 D   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain D from PDB  Type:PROTEIN  Length:257
 aligned with FABI_ECOLI | P0AEK4 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_ECOLI     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6d_ D: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6D00 D:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
           Pfam domains (1) -----------adh_short_C2-1qg6D01 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (1)
           Pfam domains (2) -----------adh_short_C2-1qg6D02 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (2)
           Pfam domains (3) -----------adh_short_C2-1qg6D03 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (3)
           Pfam domains (4) -----------adh_short_C2-1qg6D04 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (4)
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 D   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       


Chain D from PDB  Type:PROTEIN  Length:257
 aligned with FABI_SHIFL | P0AEK6 from UniProtKB/Swiss-Prot  Length:262

    Alignment length:257
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       
           FABI_SHIFL     2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
               SCOP domains d1qg6d_ D: Enoyl-ACP reductase                                                                                                                                                                                                                                    SCOP domains
               CATH domains 1qg6D00 D:2-258 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                               CATH domains
           Pfam domains (1) -----------adh_short_C2-1qg6D01 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (1)
           Pfam domains (2) -----------adh_short_C2-1qg6D02 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (2)
           Pfam domains (3) -----------adh_short_C2-1qg6D03 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (3)
           Pfam domains (4) -----------adh_short_C2-1qg6D04 D:13-252                                                                                                                                                                                                                   ------ Pfam domains (4)
         Sec.struct. author ......eeee.......hhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhh....eee....hhhhhhhhhhhhh........eee.....hhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh......eeeeeeehhhhh......hhhhhhhhhhhhhhhhhhhhhh...eeeeeeee.....hhhhhh.hhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhh..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qg6 D   2 GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMNE 258
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric/Biological Unit
(-)
Clan: NADP_Rossmann (1239)

(-) Gene Ontology  (14, 34)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B,C,D   (FABI_ECO57 | P0AEK5)
molecular function
    GO:0004318    enoyl-[acyl-carrier-protein] reductase (NADH) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH + H+.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0009102    biotin biosynthetic process    The chemical reactions and pathways resulting in the formation of biotin, cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid.
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0030497    fatty acid elongation    The elongation of a fatty acid chain by the sequential addition of two-carbon units.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0051289    protein homotetramerization    The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

Chain A,B,C,D   (FABI_ECOLI | P0AEK4)
molecular function
    GO:0004318    enoyl-[acyl-carrier-protein] reductase (NADH) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH + H+.
    GO:0042802    identical protein binding    Interacting selectively and non-covalently with an identical protein or proteins.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0009102    biotin biosynthetic process    The chemical reactions and pathways resulting in the formation of biotin, cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid.
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0030497    fatty acid elongation    The elongation of a fatty acid chain by the sequential addition of two-carbon units.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0008610    lipid biosynthetic process    The chemical reactions and pathways resulting in the formation of lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0051289    protein homotetramerization    The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.
cellular component
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

Chain A,B,C,D   (FABI_SHIFL | P0AEK6)
molecular function
    GO:0004318    enoyl-[acyl-carrier-protein] reductase (NADH) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH + H+.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0009102    biotin biosynthetic process    The chemical reactions and pathways resulting in the formation of biotin, cis-tetrahydro-2-oxothieno(3,4-d)imidazoline-4-valeric acid.
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0030497    fatty acid elongation    The elongation of a fatty acid chain by the sequential addition of two-carbon units.
    GO:0006631    fatty acid metabolic process    The chemical reactions and pathways involving fatty acids, aliphatic monocarboxylic acids liberated from naturally occurring fats and oils by hydrolysis.
    GO:0006629    lipid metabolic process    The chemical reactions and pathways involving lipids, compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent. Includes fatty acids; neutral fats, other fatty-acid esters, and soaps; long-chain (fatty) alcohols and waxes; sphingoids and other long-chain bases; glycolipids, phospholipids and sphingolipids; and carotenes, polyprenols, sterols, terpenes and other isoprenoids.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0051289    protein homotetramerization    The formation of a protein homotetramer, a macromolecular structure consisting of four noncovalently associated identical subunits.
    GO:0046677    response to antibiotic    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an antibiotic stimulus. An antibiotic is a chemical substance produced by a microorganism which has the capacity to inhibit the growth of or to kill other microorganisms.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TCL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qg6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qg6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FABI_ECO57 | P0AEK5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FABI_ECOLI | P0AEK4
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  FABI_SHIFL | P0AEK6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.3.1.9
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  FABI_ECO57 | P0AEK5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FABI_ECOLI | P0AEK4
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  FABI_SHIFL | P0AEK6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        FABI_ECO57 | P0AEK5: 1c14 1d8a 1dfg 1dfh 1dfi 1i2z 1i30 1lx6 1lxc 1mfp 1qsg
        FABI_ECOLI | P0AEK4: 1c14 1d8a 1dfg 1dfh 1dfi 1i2z 1i30 1lx6 1lxc 1mfp 1qsg 2fhs 3pjd 3pje 3pjf 4jqc 4jx8 5cfz 5cg1 5cg2
        FABI_SHIFL | P0AEK6: 1c14 1d8a 1dfg 1dfh 1dfi 1i2z 1i30 1lx6 1lxc 1mfp 1qsg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QG6)