Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)

(-) Description

Title :  THE CRYSTAL STRUCTURE OF ANTHRANILATE SYNTHASE FROM SULFOLOBUS SOLFATARICUS
 
Authors :  T. Knoechel, A. Ivens, G. Hester, A. Gonzalez, R. Bauerle, M. Wilmanns, K. Kirschner, J. N. Jansonius
Date :  20 May 99  (Deposition) - 18 Aug 99  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (2x)
Keywords :  Tryptophan Biosynthesis, Anthranilate Synthase, Glutamine Amidotransferase, Allosteric Interaction, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  T. Knochel, A. Ivens, G. Hester, A. Gonzalez, R. Bauerle, M. Wilmanns, K. Kirschner, J. N. Jansonius
The Crystal Structure Of Anthranilate Synthase From Sulfolobus Solfataricus: Functional Implications.
Proc. Natl. Acad. Sci. Usa V. 96 9479 1999
PubMed-ID: 10449718  |  Reference-DOI: 10.1073/PNAS.96.17.9479
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - PROTEIN (ANTHRANILATE SYNTHASE (TRPE-SUBUNIT))
    ChainsA
    EC Number4.1.3.27
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System Taxid562
    FragmentAMINODEOXYISOCHORISMATE SYNTHASE/LYASE SUBUNIT
    Organism ScientificSULFOLOBUS SOLFATARICUS
    Organism Taxid2287
    Other DetailsCONTAINS RESIDUES GLY-3,SER-2, HIS-1 PRIOR TO THE INITIATING METHIONINE
 
Molecule 2 - PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    ChainsB
    EC Number4.1.3.27
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET15B
    Expression System Taxid562
    FragmentGLUTAMINE AMIDOTRANSFERASE SUBUNIT
    Organism ScientificSULFOLOBUS SOLFATARICUS
    Organism Taxid2287

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1QDL)

(-) Sites  (0, 0)

(no "Site" information available for 1QDL)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1QDL)

(-) Cis Peptide Bonds  (3, 3)

Asymmetric Unit
No.Residues
1Phe A:329 -Pro A:330
2Ala A:337 -Pro A:338
3Arg B:145 -Pro B:146

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1QDL)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1QDL)

(-) Exons   (0, 0)

(no "Exon" information available for 1QDL)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:416
 aligned with TRPE_SULSO | Q06128 from UniProtKB/Swiss-Prot  Length:421

    Alignment length:422
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                    
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419  
           TRPE_SULSO     - -MEVHPISEFASPFEVFKCIERDFKVAGLLESIGGPQYKARYSVIAWSTNGYLKIHDDPVNILNGYLKDLKLADIPGLFKGGMIGYISYDAVRFWEKIRDLKPAAEDWPYAEFFTPDNIIIYDHNEGKVYVNADLSSVGGCGDIGEFKVSFYDESLNKNSYERIVSESLEYIRSGYIFQVVLSRFYRYIFSGDPLRIYYNLRRINPSPYMFYLKFDEKYLIGSSPELLFRVQDNIVETYPIAGTRPRGADQEEDLKLELELMNSEKDKAEHLMLVDLARNDLGKVCVPGTVKVPELMYVEKYSHVQHIVSKVIGTLKKKYNALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGAVGFISADGNAEFAIAIRTAFLNKELLRIHAGAGIVYDSNPESEYFETEHKLKALKTAIGVR 421
               SCOP domains d1qdla_ A: Anthranilate synthase a      minodeoxyisochorismate synthase/lyase subunit, TrpE                                                                                                                                                                                                                                                                                                                                            SCOP domains
               CATH domains 1qdlA00 A:-1-421 Anthranilate synt      hase                                                                                                                                                                                                                                                                                                                                                                                           CATH domains
               Pfam domains --------Anth_synt_I_N-1qdlA01 A:8-      130                                                                                        -------------------------Chorismate_bind-1qdlA02 A:156-410                                                                                                                                                                                                                              ----------- Pfam domains
         Sec.struct. author .eeeee.hhh.hhhhhhhhhhhhh..........------............eee..hhhhhhhh................eeeeee.hhhhhhh...............eeee.............eeeee........................hhhhhhhhhhhhhhhhhhh..................hhhhhhhhhhhh.....................eeeeee..eeee..eeeeee...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.......eeeeeeeeee...eeeeeeeeeee.....hhhhhhhhhh.hhhh...hhhhhhhhhhhhh........eeeeeee....eeeeee.......................hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qdl A  -1 AMEVHPISEFASPFEVFKCIERDFKVAGLLESIG------RYSVIAWSTNGYLKIHDDPVNILNGYLKDLKLADIPGLFKGGMIGYISYDAVRFWEKIRDLKPAAEDWPYAEFFTPDNIIIYDHNEGKVYVNADLSSVGGCGDIGEFKVSFYDESLNKNSYERIVSESLEYIRSGYIFQVVLSRFYRYIFSGDPLRIYYNLRRINPSPYMFYLKFDEKYLIGSSPELLFRVQDNIVETYPIAGTRPRGADQEEDLKLELELMNSEKDKAEHLMLVDLARNDLGKVCVPGTVKVPELMYVEKYSHVQHIVSKVIGTLKKKYNALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGAVGFISADGNAEFAIAIRTAFLNKELLRIHAGAGIVYDSNPESEYFETEHKLKALKTAIGVR 421
                            ||       9        19        29   |     -|       49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419  
                            ||                              33     40                                                                                                                                                                                                                                                                                                                                                                                             
                           -1|                                                                                                                                                                                                                                                                                                                                                                                                                                    
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                    

Chain B from PDB  Type:PROTEIN  Length:195
 aligned with TRPG_SULSO | Q06129 from UniProtKB/Swiss-Prot  Length:195

    Alignment length:195
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190     
           TRPG_SULSO     1 MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRIIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV 195
               SCOP domains d1qdlb_ B: Anthranilate synthase GAT subunit, TrpG                                                                                                                                                  SCOP domains
               CATH domains 1qdlB00 B:1-195  [code=3.40.50.880, no name defined]                                                                                                                                                CATH domains
               Pfam domains ----GATase-1qdlB01 B:5-195                                                                                                                                                                          Pfam domains
         Sec.struct. author ..eeeeee....hhhhhhhhhhhh..eeeeee....hhhhhhhhh..eeee........hhhhhhhhhhhhhhhh....eeeehhhhhhhhhhh..eeeeeeeeeeeeeeeeee..............eeeeeeeeeeeee.....eeeeeee.....eeeeee....eeee..........hhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1qdl B   1 MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERIDPDRLIISPGPGTPEKREDIGVSLDVIKYLGKRTPILGVCLGHQAIGYAFGAKIRRARKVFHGKISNIILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVDAISAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNRV 195
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (2, 2)

Asymmetric Unit

(-) CATH Domains  (2, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (3, 3)

Asymmetric Unit

(-) Gene Ontology  (13, 19)

Asymmetric Unit(hide GO term definitions)
Chain A   (TRPE_SULSO | Q06128)
molecular function
    GO:0004049    anthranilate synthase activity    Catalysis of the reaction: chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate.
    GO:0003824    catalytic activity    Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0016833    oxo-acid-lyase activity    Catalysis of the cleavage of a C-C bond by other means than by hydrolysis or oxidation, of a 3-hydroxy acid.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0009058    biosynthetic process    The chemical reactions and pathways resulting in the formation of substances; typically the energy-requiring part of metabolism in which simpler substances are transformed into more complex ones.
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0000162    tryptophan biosynthetic process    The chemical reactions and pathways resulting in the formation of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid; tryptophan is synthesized from chorismate via anthranilate.

Chain B   (TRPG_SULSO | Q06129)
molecular function
    GO:0004049    anthranilate synthase activity    Catalysis of the reaction: chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate.
    GO:0016829    lyase activity    Catalysis of the cleavage of C-C, C-O, C-N and other bonds by other means than by hydrolysis or oxidation, or conversely adding a group to a double bond. They differ from other enzymes in that two substrates are involved in one reaction direction, but only one in the other direction. When acting on the single substrate, a molecule is eliminated and this generates either a new double bond or a new ring.
biological process
    GO:0009073    aromatic amino acid family biosynthetic process    The chemical reactions and pathways resulting in the formation of aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
    GO:0008652    cellular amino acid biosynthetic process    The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
    GO:0006541    glutamine metabolic process    The chemical reactions and pathways involving glutamine, 2-amino-4-carbamoylbutanoic acid.
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
    GO:0000162    tryptophan biosynthetic process    The chemical reactions and pathways resulting in the formation of tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid; tryptophan is synthesized from chorismate via anthranilate.
cellular component
    GO:0005950    anthranilate synthase complex    A heterotetrameric enzyme complex made up of two components I and two components II. Catalyzes the formation of anthranilate, pyruvate and L-glutamate from chorismate and L-glutamine.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qdl)
 
  Sites
(no "Sites" information available for 1qdl)
 
  Cis Peptide Bonds
    Ala A:337 - Pro A:338   [ RasMol ]  
    Arg B:145 - Pro B:146   [ RasMol ]  
    Phe A:329 - Pro A:330   [ RasMol ]  
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1qdl
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRPE_SULSO | Q06128
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  TRPG_SULSO | Q06129
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.1.3.27
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRPE_SULSO | Q06128
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  TRPG_SULSO | Q06129
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1QDL)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1QDL)