1QBE - JenaLib

Biol.Unit 1 - manually (Jmol Viewer)

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Title :   BACTERIOPHAGE Q BETA CAPSID

Authors :   L. Liljas, R. Golmohammadi

Date :   10 Jan 96 (Deposition) - 11 Jul 96 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.50

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A,B,C  (60x)

Keywords :   Coat Protein, Rna Binding, Icosahedral Virus (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   R. Golmohammadi, K. Fridborg, M. Bundule, K. Valegard, L. Liljas
The Crystal Structure Of Bacteriophage Q Beta At 3. 5 A Resolution.
Structure V. 4 543 1996
PubMed-ID: 8736553 | Reference-DOI: 10.1016/S0969-2126(96)00060-3
(for further references see the PDB file header)

Molecule 1 - BACTERIOPHAGE Q BETA CAPSID
	Chains	:	A, B, C
	Organism Scientific	:	ENTEROBACTERIA PHAGE QBETA
	Organism Taxid	:	39803

		1	2	3
Asymmetric Unit	:	A	B	C
Biological Unit 1 (60x)	:	A	B	C

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 1QBE)

(no "Site" information available for 1QBE)

(no "SS Bond" information available for 1QBE)

(no "Cis Peptide Bond" information available for 1QBE)

Asymmetric Unit (2, 6)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CAPSD_BPQBE_001 *	A	34	S	CAPSD_BPQBE	---	---	A/B/C	A	33	S
2	UniProt	VAR_CAPSD_BPQBE_002 *	T	76	A	CAPSD_BPQBE	---	---	A/B/C	T	75	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (2, 360)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_CAPSD_BPQBE_001 *	A	34	S	CAPSD_BPQBE	---	---	A/B/C	A	33	S
2	UniProt	VAR_CAPSD_BPQBE_002 *	T	76	A	CAPSD_BPQBE	---	---	A/B/C	T	75	A
	* ID not provided by source

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 1QBE)

(no "Exon" information available for 1QBE)

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:123
 aligned with CAPSD_BPQBE | P03615 from UniProtKB/Swiss-Prot  Length:133

    Alignment length:132
                                    11        21        31        41        51        61        71        81        91       101       111       121       131  
          CAPSD_BPQBE     2 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY 133
               SCOP domains d1qbea_ A: Qbeta coat protein                                                                                                        SCOP domains
               CATH domains 1qbeA00 A:1-132 MS2 Viral Coat Protein                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeee.....eeeeeeeeeee....eeeeee....hhh..eeeeeee..-----.eeeeeeeeeeeee.----...eeeeeeeeeeeeee.....hhhhhhhhhhhhhhhh.hhhhhhh....... Sec.struct. author
                 SAPs(SNPs) --------------------------------S-----------------------------------------A--------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qbe A   1 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQP-----NYKVQVKIQNPTACT----CDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY 132
                                    10        20        30        40        50    |    -|       70    |   80        90       100       110       120       130  
                                                                                 55    61            75   80

Chain B from PDB  Type:PROTEIN  Length:132
 aligned with CAPSD_BPQBE | P03615 from UniProtKB/Swiss-Prot  Length:133

    Alignment length:132
                                    11        21        31        41        51        61        71        81        91       101       111       121       131  
          CAPSD_BPQBE     2 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY 133
               SCOP domains d1qbeb_ B: Qbeta coat protein                                                                                                        SCOP domains
               CATH domains 1qbeB00 B:1-132 MS2 Viral Coat Protein                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeee......eeeeeeeeee....eeeeee....hhh..eeeeeee........eeeeeeeeeeeee........eeeeeeeeeeeeee.....hhhhhhhhhhhhhhhh.hhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------S-----------------------------------------A--------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qbe B   1 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY 132
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain C from PDB  Type:PROTEIN  Length:123
 aligned with CAPSD_BPQBE | P03615 from UniProtKB/Swiss-Prot  Length:133

    Alignment length:132
                                    11        21        31        41        51        61        71        81        91       101       111       121       131  
          CAPSD_BPQBE     2 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY 133
               SCOP domains d1qbec_ C: Qbeta coat protein                                                                                                        SCOP domains
               CATH domains 1qbeC00 C:1-132 MS2 Viral Coat Protein                                                                                               CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .....eeeeee.....eeeeeeeeeee....eeeeee....hhh..eeeeeee..-----.eeeeeeeeeeeee.----...eeeeeeeeeeeeee.....hhhhhhhhhhhhhhhh.hhhhhhhh...... Sec.struct. author
                 SAPs(SNPs) --------------------------------S-----------------------------------------A--------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 1qbe C   1 AKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQP-----NYKVQVKIQNPTACT----CDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY 132
                                    10        20        30        40        50    |    -|       70    |   80        90       100       110       120       130  
                                                                                 55    61            75   80

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: RNA bacteriophage capsid protein (40)

Superfamily: RNA bacteriophage capsid protein (40)

Family: RNA bacteriophage capsid protein (40)

Protein domain: Qbeta coat protein (1)

Bacteriophage Qbeta [TaxId: 39803] (1)

1a	d1qbea_	A:
1b	d1qbeb_	B:
1c	d1qbec_	C:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: MS2 Viral Coat Protein (42)

Homologous Superfamily: MS2 Viral Coat Protein (42)

Enterobacteria phage qbeta. Organism_taxid: 39803 (1)

1a	1qbeB00	B:1-132
1b	1qbeA00	A:1-132
1c	1qbeC00	C:1-132

(no "Pfam Domain" information available for 1QBE)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (CAPSD_BPQBE | P03615)

molecular function
	GO:0003723	RNA binding	Interacting selectively and non-covalently with an RNA molecule or a portion thereof.
	GO:0005198	structural molecule activity	The action of a molecule that contributes to the structural integrity of a complex or its assembly within or outside a cell.
cellular component
	GO:0039617	T=3 icosahedral viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles where the subunits (capsomeres) are arranged to form an icosahedron with T=3 symmetry. The T=3 capsid is composed of 12 pentameric and 20 hexameric capsomeres.
	GO:0019028	viral capsid	The protein coat that surrounds the infective nucleic acid in some virus particles. It comprises numerous regularly arranged subunits, or capsomeres.
	GO:0019012	virion	The complete fully infectious extracellular virus particle.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qbe)

	Sites
(no "Sites" information available for 1qbe)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qbe)

Biological Unit
	Complete Structure
		Biological Unit 1	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	1qbe
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CAPSD_BPQBE \| P03615
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	CAPSD_BPQBE \| P03615
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	CAPSD_BPQBE \| P03615	:	4l8h 5kip

(no "Related Entries Specified in the PDB File" available for 1QBE)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (2, 6)

PROSITE Motifs (0, 0)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (0, 0)

Gene Ontology (5, 5)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File