1QB3 - JenaLib

Title :   CRYSTAL STRUCTURE OF THE CELL CYCLE REGULATORY PROTEIN CKS1

Authors :   Y. Bourne, M. H. Watson, A. S. Arvai, S. L. Bernstein, S. I. Reed, J. A. Tai

Date :   30 Apr 99 (Deposition) - 31 Aug 00 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.00

Chains :   Asym. Unit : A,B,C
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C  (2x)
Biol. Unit 3: B  (4x)
Biol. Unit 4: A,C  (1x)
Biol. Unit 5: B  (2x)

Keywords :   Cell Cycle Mutagenesis Domain Swapping, Cyclin-Dependent Kinase, Cell Cycle (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Bourne, M. H. Watson, A. S. Arvai, S. L. Bernstein, S. I. Reed, J. A. Tainer
Crystal Structure And Mutational Analysis Of The Saccharomyces Cerevisiae Cell Cycle Regulatory Protein Cks1 Implications For Domain Swapping, Anion Binding And Protein Interactions.
Structure Fold. Des. V. 8 841 2000
PubMed-ID: 10997903 | Reference-DOI: 10.1016/S0969-2126(00)00175-1

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 6)

Asymmetric Unit (2, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_YEAST	30-48	3	A:30-48 B:230-248 C:430-448
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_YEAST	91-101	3	A:91-101 B:291-301 C:491-501

Biological Unit 1 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_YEAST	30-48	2	A:30-48 B:230-248 -
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_YEAST	91-101	2	A:91-101 B:291-301 -

Biological Unit 2 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_YEAST	30-48	2	- - C:430-448
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_YEAST	91-101	2	- - C:491-501

Biological Unit 3 (2, 8)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_YEAST	30-48	4	- B:230-248 -
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_YEAST	91-101	4	- B:291-301 -

Biological Unit 4 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_YEAST	30-48	2	A:30-48 - C:430-448
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_YEAST	91-101	2	A:91-101 - C:491-501

Biological Unit 5 (2, 4)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	CKS_1	PS00944	Cyclin-dependent kinases regulatory subunits signature 1.	CKS1_YEAST	30-48	2	- B:230-248 -
2	CKS_2	PS00945	Cyclin-dependent kinases regulatory subunits signature 2.	CKS1_YEAST	91-101	2	- B:291-301 -

Exons (1, 3)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:113
 aligned with CKS1_YEAST | P20486 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:113
                                    15        25        35        45        55        65        75        85        95       105       115   
           CKS1_YEAST     6 HAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQ 118
               SCOP domains d1qb3a_ A: cks1                                                                                                   SCOP domains
               CATH domains 1qb3A00 A:6-118 Cyclin-Dependent Kinase Subunit Type 2                                                            CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhee...ee...eeeeeee.hhhhhhhhhhhh...........hhhhhhhh........eee........eeeeeee.hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------CKS_1  PDB: A:30-48------------------------------------------CKS_2      ----------------- PROSITE
               Transcript 1 Exon 1.1  PDB: A:6-118 UniProt: 1-150 [INCOMPLETE]                                                                Transcript 1
                 1qb3 A   6 HAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQ 118
                                    15        25        35        45        55        65        75        85        95       105       115

Chain B from PDB  Type:PROTEIN  Length:119
 aligned with CKS1_YEAST | P20486 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:119
                                    15        25        35        45        55        65        75        85        95       105       115         
           CKS1_YEAST     6 HAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQQQQQ 124
               SCOP domains d1qb3b_ B: cks1                                                                                                         SCOP domains
               CATH domains 1qb3B00 B:206-324 Cyclin-Dependent Kinase Subunit Type 2                                                                CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhhhhhhhhhhhee...ee....ee..ee.hhhhhhhhhhhh...........hhhhhhhh...........................hhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------CKS_1              ------------------------------------------CKS_2      ----------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:206-324 UniProt: 1-150 [INCOMPLETE]                                                                    Transcript 1
                 1qb3 B 206 HAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAATAAAQQQQQQQ 324
                                   215       225       235       245       255       265       275       285       295       305       315

Chain C from PDB  Type:PROTEIN  Length:109
 aligned with CKS1_YEAST | P20486 from UniProtKB/Swiss-Prot  Length:150

    Alignment length:109
                                    15        25        35        45        55        65        75        85        95       105         
           CKS1_YEAST     6 HAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAAT 114
               SCOP domains d1qb3c_ C: cks1                                                                                               SCOP domains
               CATH domains 1qb3C00 C:406-514 Cyclin-Dependent Kinase Subunit Type 2                                                      CATH domains
           Pfam domains (1) ---------------------CKS-1qb3C01 C:427-505                                                          --------- Pfam domains (1)
           Pfam domains (2) ---------------------CKS-1qb3C02 C:427-505                                                          --------- Pfam domains (2)
           Pfam domains (3) ---------------------CKS-1qb3C03 C:427-505                                                          --------- Pfam domains (3)
         Sec.struct. author ........hhhhhhhhhhhhhhhee...ee...eeeeeee.hhhhhhhhhhhh...........hhhhhhhh........eee........eeeeeee.hhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------CKS_1              ------------------------------------------CKS_2      ------------- PROSITE
               Transcript 1 Exon 1.1  PDB: C:406-514 UniProt: 1-150 [INCOMPLETE]                                                          Transcript 1
                 1qb3 C 406 HAFQGRKLTDQERARVLEFQDSIHYSPRYSDDNYEYRHVMLPKAMLKVIPSDYFNSEVGTLRILTEDEWRGLGITQSLGWEHYECHAPEPHILLFKRPLNYEAELRAAT 514
                                   415       425       435       445       455       465       475       485       495       505

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 3)

CATH Domains (1, 3)

Pfam Domains (1, 3)

Gene Ontology (14, 14)

Asymmetric Unit(hide GO term definitions)

Chain A,B,C (CKS1_YEAST | P20486)

molecular function
	GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	Modulates the activity of a cyclin-dependent protein serine/threonine kinase, enzymes of the protein kinase family that are regulated through association with cyclins and other proteins.
	GO:0042393	histone binding	Interacting selectively and non-covalently with a histone, any of a group of water-soluble proteins found in association with the DNA of eukaroytic chromosomes. They are involved in the condensation and coiling of chromosomes during cell division and have also been implicated in nonspecific suppression of gene activity.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0030295	protein kinase activator activity	Binds to and increases the activity of a protein kinase, an enzyme which phosphorylates a protein.
	GO:0043130	ubiquitin binding	Interacting selectively and non-covalently with ubiquitin, a protein that when covalently bound to other cellular proteins marks them for proteolytic degradation.
biological process
	GO:0032147	activation of protein kinase activity	Any process that initiates the activity of an inactive protein kinase.
	GO:0007049	cell cycle	The progression of biochemical and morphological phases and events that occur in a cell during successive cell replication or nuclear replication events. Canonically, the cell cycle comprises the replication and segregation of genetic material followed by the division of the cell, but in endocycles or syncytial cells nuclear replication or nuclear division may not be followed by cell division.
	GO:0051301	cell division	The process resulting in division and partitioning of components of a cell to form more cells; may or may not be accompanied by the physical separation of a cell into distinct, individually membrane-bounded daughter cells.
	GO:0045893	positive regulation of transcription, DNA-templated	Any process that activates or increases the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0007346	regulation of mitotic cell cycle	Any process that modulates the rate or extent of progress through the mitotic cell cycle.
	GO:0060303	regulation of nucleosome density	Any process that modulates the number of nucleosomes in a given region of a chromosome.
	GO:0045859	regulation of protein kinase activity	Any process that modulates the frequency, rate or extent of protein kinase activity.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
cellular component
	GO:0000307	cyclin-dependent protein kinase holoenzyme complex	Cyclin-dependent protein kinases (CDKs) are enzyme complexes that contain a kinase catalytic subunit associated with a regulatory cyclin partner.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1qb3)

	Sites
(no "Sites" information available for 1qb3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1qb3)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]
		Biological Unit 4	[ Jena3D ]
		Biological Unit 5	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	1qb3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	CKS1_YEAST \| P20486
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description