Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  RV1170 (MSHB) FROM MYCOBACTERIUM TUBERCULOSIS
 
Authors :  A. A. Mccarthy, N. A. Peterson, R. Knijff, E. N. Baker, Tb Structural Genomics Consortium (Tbsgc)
Date :  20 Aug 03  (Deposition) - 13 Jan 04  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Modified Rossmann Fold, Structural Genomics, Psi, Protein Structure Initiative, Tb Structural Genomics Consortium, Tbsgc, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. A. Mccarthy, N. A. Peterson, R. Knijff, E. N. Baker
Crystal Structure Of Mshb From Mycobacterium Tuberculosis, A Deacetylase Involved In Mycothiol Biosynthesis.
J. Mol. Biol. V. 335 1131 2004
PubMed-ID: 14698305  |  Reference-DOI: 10.1016/J.JMB.2003.11.034
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL PROTEIN RV1170
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PPROEX-HT
    Expression System Strain: BL21(DE3)(PRP)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: RV1170 (MSHB)
    Organism Scientific: MYCOBACTERIUM TUBERCULOSIS
    Organism Taxid: 1773
    Synonym: MSHB, LMBE-RELATED PROTEIN

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric Unit (2, 5)
No.NameCountTypeFull Name
1BOG3Ligand/IonB-OCTYLGLUCOSIDE
2SO42Ligand/IonSULFATE ION
Biological Unit 1 (2, 3)
No.NameCountTypeFull Name
1BOG2Ligand/IonB-OCTYLGLUCOSIDE
2SO41Ligand/IonSULFATE ION
Biological Unit 2 (2, 2)
No.NameCountTypeFull Name
1BOG1Ligand/IonB-OCTYLGLUCOSIDE
2SO41Ligand/IonSULFATE ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWARETYR A:-4 , SER A:30 , ARG A:31 , ASP A:291 , LEU A:293 , PHE A:298 , HOH A:517 , HOH A:552 , HOH A:646 , PRO B:114 , VAL B:153BINDING SITE FOR RESIDUE BOG A 401
2AC2SOFTWAREHIS B:13 , ASP B:15 , ASP B:16 , ARG B:68 , HIS B:147 , GLN B:247 , LEU B:259 , HOH B:547BINDING SITE FOR RESIDUE BOG B 402
3AC3SOFTWAREHIS A:13 , GLU A:45 , GLY A:46 , ARG A:68 , ASP A:95 , GLY A:97 , HIS A:144 , HOH A:599 , HOH A:639BINDING SITE FOR RESIDUE BOG A 403
4AC4SOFTWAREARG A:52 , ALA A:282 , ARG A:283 , HOH A:567BINDING SITE FOR RESIDUE SO4 A 501
5AC5SOFTWAREARG B:203 , ALA B:294 , GLY B:295 , LEU B:296 , GLY B:297 , PHE B:298 , THR B:299 , HOH B:591 , HOH B:619 , HOH B:635BINDING SITE FOR RESIDUE SO4 B 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1Q7T)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1Q7T)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1Q7T)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1Q7T)

(-) Exons   (0, 0)

(no "Exon" information available for 1Q7T)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:310
 aligned with MSHB_MYCTO | P9WJN2 from UniProtKB/Swiss-Prot  Length:303

    Alignment length:316
                                         1                                                                                                                                                                                                                                                                                                              
                                     -   |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297      
           MSHB_MYCTO     - -------------MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT 303
               SCOP domains d1q7ta_ A: 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1q7tA00 A:-12-303 LmbE-like                                                                                                                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..ee...eeeeee...hhhhhhhhhhhhhhhhh..eeeeee.............hhhhh.....hhhhhhhhhhhhhhhhh.....ee.....................hhhhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhhhhhhh..------........eeeeeeeehhhhhhhhhh.hhhhh.......hhhhh..ee......eeee.hhhhhhhhhhhhhhh....ee.....eee.....eee...eeeeeeee....................eee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q7t A -12 DIPTTENLYFQGAMSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVG------PGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT 303
                                    -3         7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157      |  -   |   177       187       197       207       217       227       237       247       257       267       277       287       297      
                                                                                                                                                                                                          164    171                                                                                                                                    


Chain A from PDB  Type:PROTEIN  Length:310
 aligned with MSHB_MYCTU | P9WJN3 from UniProtKB/Swiss-Prot  Length:303

    Alignment length:316
                                         1                                                                                                                                                                                                                                                                                                              
                                     -   |     7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297      
           MSHB_MYCTU     - -------------MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT 303
               SCOP domains d1q7ta_ A: 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD                                                                                                                                                                                                                                      SCOP domains
               CATH domains 1q7tA00 A:-12-303 LmbE-like                                                                                                                                                                                                                                                                                                  CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........eee..ee...eeeeee...hhhhhhhhhhhhhhhhh..eeeeee.............hhhhh.....hhhhhhhhhhhhhhhhh.....ee.....................hhhhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhhhhhhh..------........eeeeeeeehhhhhhhhhh.hhhhh.......hhhhh..ee......eeee.hhhhhhhhhhhhhhh....ee.....eee.....eee...eeeeeeee....................eee... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q7t A -12 DIPTTENLYFQGAMSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVG------PGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTASGT 303
                                    -3         7        17        27        37        47        57        67        77        87        97       107       117       127       137       147       157      |  -   |   177       187       197       207       217       227       237       247       257       267       277       287       297      
                                                                                                                                                                                                          164    171                                                                                                                                    


Chain B from PDB  Type:PROTEIN  Length:291
 aligned with MSHB_MYCTO | P9WJN2 from UniProtKB/Swiss-Prot  Length:303

    Alignment length:297
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       
           MSHB_MYCTO     3 ETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT 299
               SCOP domains d1q7tb_ B: 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD                                                                                                                                                                                                                   SCOP domains
               CATH domains 1q7tB00 B:3-299 LmbE-like                                                                                                                                                                                                                                                                                 CATH domains
           Pfam domains (1) -----PIG-L-1q7tB01 B:8-158                                                                                                                                  --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----PIG-L-1q7tB02 B:8-158                                                                                                                                  --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ...eeeeee...hhhhhhhhhhhhhhhhh..eeeeee.............hhhhh.....hhhhhhhhhhhhhhhhh.....ee.....................hhhhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhhhhhh...------........eeeeee.hhhhhhhhhhh.hhhhh.......hhhhh..........eeee.hhhhhhhhhhhhhhh....ee.....eee.....eee...eeeeeeee...................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q7t B   3 ETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVG------PGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT 299
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162 |     172       182       192       202       212       222       232       242       252       262       272       282       292       
                                                                                                                                                                                           164    171                                                                                                                                


Chain B from PDB  Type:PROTEIN  Length:291
 aligned with MSHB_MYCTU | P9WJN3 from UniProtKB/Swiss-Prot  Length:303

    Alignment length:297
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       
           MSHB_MYCTU     3 ETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT 299
               SCOP domains d1q7tb_ B: 1D-myo-inosityl 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase MshD                                                                                                                                                                                                                   SCOP domains
               CATH domains 1q7tB00 B:3-299 LmbE-like                                                                                                                                                                                                                                                                                 CATH domains
           Pfam domains (1) -----PIG-L-1q7tB01 B:8-158                                                                                                                                  --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) -----PIG-L-1q7tB02 B:8-158                                                                                                                                  --------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (2)
         Sec.struct. author ...eeeeee...hhhhhhhhhhhhhhhhh..eeeeee.............hhhhh.....hhhhhhhhhhhhhhhhh.....ee.....................hhhhhhhhhhhhhhhhhhhhhh..eeeee.......hhhhhhhhhhhhhhhhhh...------........eeeeee.hhhhhhhhhhh.hhhhh.......hhhhh..........eeee.hhhhhhhhhhhhhhh....ee.....eee.....eee...eeeeeeee...................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1q7t B   3 ETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAGTDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVG------PGDPWTVPKFYWTVLGLSALISGARALVPDDLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFT 299
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162 |     172       182       192       202       212       222       232       242       252       262       272       282       292       
                                                                                                                                                                                           164    171
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: no clan defined [family: PIG-L] (5)

(-) Gene Ontology  (8, 14)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (MSHB_MYCTU | P9WJN3)
molecular function
    GO:0035595    N-acetylglucosaminylinositol deacetylase activity    Catalysis of the reaction: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside + H2O = 1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside + acetate. This reaction is the hydrolysis of an acetyl group from N-acetylglucosaminylinositol.
    GO:0019213    deacetylase activity    Catalysis of the hydrolysis of an acetyl group or groups from a substrate molecule.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016811    hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides    Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amide.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0010125    mycothiol biosynthetic process    The chemical reactions and pathways resulting in the formation of mycothiol, which consists of N-acetyl-L-cysteine linked to a pseudodisaccharide, D-glucosamine and myo-inositol. Mycothiol is produced in actinomycetes like mycobacteria and serves similar functions to glutathione.
cellular component
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.

Chain A,B   (MSHB_MYCTO | P9WJN2)
molecular function
    GO:0035595    N-acetylglucosaminylinositol deacetylase activity    Catalysis of the reaction: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside + H2O = 1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside + acetate. This reaction is the hydrolysis of an acetyl group from N-acetylglucosaminylinositol.
    GO:0019213    deacetylase activity    Catalysis of the hydrolysis of an acetyl group or groups from a substrate molecule.
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
    GO:0008270    zinc ion binding    Interacting selectively and non-covalently with zinc (Zn) ions.
biological process
    GO:0010125    mycothiol biosynthetic process    The chemical reactions and pathways resulting in the formation of mycothiol, which consists of N-acetyl-L-cysteine linked to a pseudodisaccharide, D-glucosamine and myo-inositol. Mycothiol is produced in actinomycetes like mycobacteria and serves similar functions to glutathione.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    BOG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1q7t)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1q7t
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  MSHB_MYCTO | P9WJN2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  MSHB_MYCTU | P9WJN3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  MSHB_MYCTO | P9WJN2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  MSHB_MYCTU | P9WJN3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        MSHB_MYCTO | P9WJN2: 1q74 4ewl
        MSHB_MYCTU | P9WJN3: 1q74 4ewl

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1Q7T)