Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF HGPRT-ASE FROM LEISHMANIA TARENTOLAE IN COMPLEX WITH GMP
 
Authors :  P. S. Monzani, S. Trapani, G. Oliva, O. H. Thiemann
Date :  11 Jul 03  (Deposition) - 27 Jul 04  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.10
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  P. S. Monzani, S. Trapani, O. H. Thiemann, G. Oliva
Crystal Structure Of Leishmania Tarentolae Hypoxanthine-Guanine Phosphoribosyltransferase.
Bmc Struct. Biol. V. 7 59 2007
PubMed-ID: 17894860  |  Reference-DOI: 10.1186/1472-6807-7-59
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    Chains: A, B
    EC Number: 2.4.2.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PET29A(+)
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: HGPRT
    Organism Scientific: LEISHMANIA TARENTOLAE
    Organism Taxid: 5689
    Synonym: HGPRT

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric/Biological Unit (1, 2)
No.NameCountTypeFull Name
15GP2Ligand/IonGUANOSINE-5'-MONOPHOSPHATE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:126 , ILE A:127 , ASP A:129 , SER A:130 , ALA A:131 , ILE A:132 , THR A:133 , LYS A:157 , ALA A:177 , PHE A:178 , VAL A:179 , MET A:184 , ASP A:185 , HOH A:321 , HOH A:378 , HOH A:403 , HOH A:408BINDING SITE FOR RESIDUE 5GP A 301
2AC2SOFTWAREASN B:118 , ASP B:126 , ILE B:127 , ASP B:129 , SER B:130 , ALA B:131 , ILE B:132 , THR B:133 , LYS B:157 , ALA B:177 , PHE B:178 , VAL B:179 , ASP B:185 , HOH B:303 , HOH B:337 , HOH B:352 , HOH B:354 , HOH B:376 , HOH B:429 , HOH B:436BINDING SITE FOR RESIDUE 5GP B 302

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1PZM)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Leu A:65 -Lys A:66
2Leu B:65 -Lys B:66

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PZM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 1PZM)

(-) Exons   (0, 0)

(no "Exon" information available for 1PZM)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:170
 aligned with Q9NJI5_LEITA | Q9NJI5 from UniProtKB/TrEMBL  Length:210

    Alignment length:183
                                                                                                                                                                                                    189            
                                                                                                                                                                                                  188 |            
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179        |-|      198   
         Q9NJI5_LEITA    20 YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASSYGSGVETSGQVRMLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPHAFVIGYVWTFAD-LRGVPDICVLKKE 201
               SCOP domains d1pzma_ A: Hypoxanthine-guanine-xanthine PRTase                                                                                                                                         SCOP domains
               CATH domains 1pzmA00 A:20-202  [code=3.40.50.2020, no name defined]                                                                                                                                  CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...eeeeeehhhhhhhhhhhhhhhhhhhhhhhh......eeeeee...hhhhhhhhhhhhhhh...eeeeee...-------------............eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.hhhh.......eeeee.....ee...............eeee... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pzm A  20 YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICAS-------------MLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPRAFVIGYGMDFAESYRELRDICVLKKE 202
                                    29        39        49        59        69        79        89    |    -       109       119       129       139       149       159       169       179       189       199   
                                                                                                     94           108                                                                                              


Chain B from PDB  Type:PROTEIN  Length:170
 aligned with Q9NJI5_LEITA | Q9NJI5 from UniProtKB/TrEMBL  Length:210

    Alignment length:182
                                                                                                                                                                                                    189           
                                                                                                                                                                                                  188 |           
                                    29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179        |-|      198  
         Q9NJI5_LEITA    20 YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICASSYGSGVETSGQVRMLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPHAFVIGYVWTFAD-LRGVPDICVLKK 200
               SCOP domains d1pzmb_ B: Hypoxanthine-guanine-xanthine PRTase                                                                                                                                        SCOP domains
               CATH domains 1pzmB00 B:20-201  [code=3.40.50.2020, no name defined]                                                                                                                                 CATH domains
           Pfam domains (1) ----Pribosyltran-1pzmB01 B:24-155                                                                                                       ---------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----Pribosyltran-1pzmB02 B:24-155                                                                                                       ---------------------------------------------- Pfam domains (2)
         Sec.struct. author ....eeeeehhhhhhhhhhhhhhhhhhhhhhhh......eeeeee...hhhhhhhhhhhhhhh...eeeeee..------------hhhhhhhhh.....eeeeeeeee..hhhhhhhhhhhhh....eeeeeeeee.hhhh.......eeeee....eee...............eeee.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1pzm B  20 YPMSARTLVTQEQVWAATAKCAKKIAADYKDFHLTADNPLYLLCVLKGSFIFTADLARFLADEGVPVKVEFICA------------VRMLLDVRDSVENRHIMLVEDIVDSAITLQYLMRFMLAKKPASLKTVVLLDKPSGRKVDVLVDYPVITIPRAFVIGYGMDFAESYRELRDICVLKK 201
                                    29        39        49        59        69        79        89   |     -      |109       119       129       139       149       159       169       179       189       199  
                                                                                                    93          106
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: PRTase-like (59)

(-) Gene Ontology  (6, 6)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q9NJI5_LEITA | Q9NJI5)
molecular function
    GO:0004422    hypoxanthine phosphoribosyltransferase activity    Catalysis of the reaction: IMP + diphosphate = hypoxanthine + 5-phospho-alpha-D-ribose 1-diphosphate.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016757    transferase activity, transferring glycosyl groups    Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).
biological process
    GO:0009116    nucleoside metabolic process    The chemical reactions and pathways involving a nucleoside, a nucleobase linked to either beta-D-ribofuranose (a ribonucleoside) or 2-deoxy-beta-D-ribofuranose, (a deoxyribonucleoside), e.g. adenosine, guanosine, inosine, cytidine, uridine and deoxyadenosine, deoxyguanosine, deoxycytidine and thymidine (= deoxythymidine).
    GO:0006166    purine ribonucleoside salvage    Any process which produces a purine nucleoside from derivatives of it, without de novo synthesis.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5GP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:65 - Lys A:66   [ RasMol ]  
    Leu B:65 - Lys B:66   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1pzm
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9NJI5_LEITA | Q9NJI5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q9NJI5_LEITA | Q9NJI5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1PZM)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PZM)