Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE NATIVE CNERG1 ERGTOXIN, A HIGHLY SPECIFIC INHIBITOR OF HERG CHANNEL
 
Authors :  K. Frenal, K. Wecker, G. B. Gurrola, L. D. Possani, N. Wolff, M. Delepierre
Date :  03 Jul 03  (Deposition) - 22 Jun 04  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A
Keywords :  Alpha/Beta Molecular Scaffold, Toxin (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  K. Frenal, C. Q. Xu, N. Wolff, K. Wecker, G. B. Gurrola, S. Y. Zhu, C. W. Chi, L. D. Possani, J. Tytgat, M. Delepierre
Exploring Structural Features Of The Interaction Between The Scorpion Toxincnerg1 And Erg K+ Channels.
Proteins V. 56 367 2004
PubMed-ID: 15211519  |  Reference-DOI: 10.1002/PROT.20102
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ERGTOXIN
    Chains: A
    Organism Common: MEXICAN SCORPION
    Organism Scientific: CENTRUROIDES NOXIUS
    Organism Taxid: 6878
    Secretion: VENOM

 Structural Features

(-) Chains, Units

  
NMR Structure : 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1PX9)

(-) Sites  (0, 0)

(no "Site" information available for 1PX9)

(-) SS Bonds  (4, 4)

NMR Structure
No.Residues
1A:5 -A:23
2A:11 -A:34
3A:20 -A:39
4A:24 -A:41

(-) Cis Peptide Bonds  (1, 1)

NMR Structure
No.Residues
1Met A:35 -Phe A:36

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1PX9)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ERGTXPS60026 Ergtoxin family signature.KGX11_CENNO25-61  1A:5-41

(-) Exons   (0, 0)

(no "Exon" information available for 1PX9)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:42
 aligned with KGX11_CENNO | Q86QT3 from UniProtKB/Swiss-Prot  Length:62

    Alignment length:42
                                    30        40        50        60  
           KGX11_CENNO   21 DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA 62
               SCOP domains d1px9a_ A:                                 SCOP domains
               CATH domains 1px9A00 A:1-42                             CATH domains
               Pfam domains Toxin_17-1px9A01 A:1-41                  - Pfam domains
         Sec.struct. author .hhhhh.......ee.hhhhhhhhhhhh...eeee...eee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------ SAPs(SNPs)
                    PROSITE ----ERGTX  PDB: A:5-41 UniProt: 25-61    - PROSITE
                 Transcript ------------------------------------------ Transcript
                  1px9 A  1 DRDSCVDKSRCAKYGYYQECQDCCKNAGHNGGTCMFFKCKCA 42
                                    10        20        30        40
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Knottin_1 (78)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (KGX11_CENNO | Q86QT3)
molecular function
    GO:0019870    potassium channel inhibitor activity    Stops, prevents, or reduces the activity of a potassium channel.
biological process
    GO:0006952    defense response    Reactions, triggered in response to the presence of a foreign body or the occurrence of an injury, which result in restriction of damage to the organism attacked or prevention/recovery from the infection caused by the attack.
    GO:0009405    pathogenesis    The set of specific processes that generate the ability of an organism to induce an abnormal, generally detrimental state in another organism.
cellular component
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1px9)
 
  Sites
(no "Sites" information available for 1px9)
 
  Cis Peptide Bonds
    Met A:35 - Phe A:36   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1px9
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  KGX11_CENNO | Q86QT3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  KGX11_CENNO | Q86QT3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        KGX11_CENNO | Q86QT3: 1ne5

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 1PX9)